1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD8a
  5. CD8 alpha Protein, Human (HEK293, His)

CD8 alpha Protein is expressed on the surface of cytotoxic T cells. It plays a crucial role in immune responses by binding to major histocompatibility complex class I molecules on target cells, enhancing T cell activation and cytotoxicity. CD8 alpha Protein is also involved in immune regulation and tolerance. Understanding its functions can aid in developing immunotherapies and vaccines. CD8 alpha Protein, Human (HEK293, His) is the recombinant human-derived CD8 alpha protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD8 alpha Protein is expressed on the surface of cytotoxic T cells. It plays a crucial role in immune responses by binding to major histocompatibility complex class I molecules on target cells, enhancing T cell activation and cytotoxicity. CD8 alpha Protein is also involved in immune regulation and tolerance. Understanding its functions can aid in developing immunotherapies and vaccines. CD8 alpha Protein, Human (HEK293, His) is the recombinant human-derived CD8 alpha protein, expressed by HEK293 , with N-6*His labeled tag.

Background

CD8 alpha, an integral membrane glycoprotein, plays a pivotal role in orchestrating immune responses against both external and internal threats. In T-cells, it serves as a coreceptor for MHC class I molecule:peptide complexes, facilitating the recognition of antigens derived from cytosolic proteins. Simultaneously interacting with the T-cell receptor (TCR) and MHC class I proteins on antigen-presenting cells (APCs), CD8 alpha recruits the Src kinase LCK to the TCR-CD3 complex, initiating intracellular signaling pathways that culminate in lymphokine production, cellular motility, adhesion, and activation of cytotoxic T-lymphocytes (CTLs). This mechanism empowers CTLs to identify and eliminate infected or tumor cells. In NK-cells, CD8 alpha homodimers at the cell surface contribute to a survival mechanism, enabling the conjugation and lysis of multiple target cells. Moreover, CD8 alpha homodimers promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells. The protein forms disulfide-linked heterodimers with CD8B on the cell surface and homodimers in various cell types, including NK-cells and peripheral blood T-lymphocytes. Interactions with the MHC class I HLA-A/B2M dimer and LCK, as well as its direct interaction with HLA-G, highlight the intricate network of molecular associations that underlie CD8 alpha's diverse functions in immune regulation.

Species

Human

Source

HEK293

Tag

N-6*His

Accession

P01732 (S22-D182)

Gene ID

925  [NCBI]

Molecular Construction
N-term
6*His
CD8 alpha (S22-D182)
Accession # P01732
C-term
Protein Length

Extracellular Domain

Synonyms
p32; T cell antigen Leu2; T cell co receptor; T-cell surface glycoprotein CD8 alpha chain; T-lymphocyte differentiation antigen T8/Leu-2; T8 T cell antigen; T8/Leu-2 T-lymphocyte differentiation antigen
AA Sequence

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Molecular Weight

Approximately 28 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD8 alpha Protein, Human (HEK293, His)
Cat. No.:
HY-P71662
Quantity:
MCE Japan Authorized Agent: