1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins
  4. CD43
  5. CD43 Protein, Human (HEK293, His)

CD43 protein is an important leukocyte surface sialic acid protein that plays a key role in T cell regulation. It has a positive impact on T cell function, including activation, proliferation, differentiation, trafficking and migration, especially by helping T cells migrate to lymph nodes through ERM proteins. CD43 Protein, Human (HEK293, His) is the recombinant human-derived CD43 protein, expressed by HEK293 , with C-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD43 protein is an important leukocyte surface sialic acid protein that plays a key role in T cell regulation. It has a positive impact on T cell function, including activation, proliferation, differentiation, trafficking and migration, especially by helping T cells migrate to lymph nodes through ERM proteins. CD43 Protein, Human (HEK293, His) is the recombinant human-derived CD43 protein, expressed by HEK293 , with C-8*His labeled tag.

Background

The CD43 protein stands out as the predominant cell surface sialoprotein of leukocytes, orchestrating a myriad of crucial functions in T-cell regulation. It exerts a positive influence on T-cell activation, proliferation, differentiation, trafficking, and migration, notably facilitating T-cell trafficking to lymph nodes through its association with ERM proteins (EZR, RDX, and MSN). While playing a role in preparing T-cells for cytokine sensing and differentiation into effector cells, CD43 negatively regulates Th2 cell differentiation and steers T-cells toward a Th1 lineage commitment. Additionally, it plays a pivotal role in inducing the expression of IFN-gamma by T-cells during T-cell receptor (TCR) activation, promoting IFNGR and IL4R signaling, and mediating the clustering of IFNGR with TCR. Acting as a major E-selectin ligand, CD43 facilitates Th17 cell rolling on activated vasculature and recruitment during inflammation, mediating Th17 cell adhesion to E-selectin. Moreover, CD43 serves as a T-cell counter-receptor for SIGLEC1, contributing to cell survival by protecting cells from apoptotic signals.

Species

Human

Source

HEK293

Tag

C-8*His

Accession

P16150 (S20-R253)

Gene ID
Molecular Construction
N-term
CD43 (S20-R253)
Accession # P16150
8*His
C-term
Protein Length

Extracellular Domain

Synonyms
Leukosialin; CD43; Ly-48; A630014B01Rik; Galgp; GPL115; LSN; Sialophorin; SPN
AA Sequence

STTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSR

Molecular Weight

50-120 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD43 Protein, Human (HEK293, His)
Cat. No.:
HY-P77887
Quantity:
MCE Japan Authorized Agent: