1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens Biotinylated Proteins
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TNF Receptor Superfamily CD40 GITR/CD357
  5. CD40 Protein, Human (Biotinylated, HEK293, Fc-Avi)

CD40 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P72909
Handling Instructions Technical Support

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6). CD40 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through TRAF6 and MAP3K8-mediated pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion. CD40 exists as monomers and homodimers and interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6). CD40 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived CD40 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

Background

CD40 Protein, acting as the receptor for TNFSF5/CD40LG, is instrumental in transducing signals through TRAF6- and MAP3K8-mediated pathways, leading to the activation of ERK in macrophages and B cells and subsequent induction of immunoglobulin secretion. Existing in both monomeric and homodimeric forms, CD40 Protein exhibits variations in its homodimeric structure, as observed in the bladder carcinoma cell line Hu549. The receptor interacts with key signaling molecules such as TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, with the crucial interaction occurring between CD40 Protein, TRAF6, and MAP3K8, thereby playing a pivotal role in ERK activation.

Species

Human

Source

HEK293

Tag

C-Avi;C-hFc

Accession

P25942-1 (E21-R193)

Gene ID

958  [NCBI]

Molecular Construction
N-term
CD40 (E21-R193)
Accession # P25942-1
hFc-Avi
C-term
Synonyms
Tumor Necrosis Factor Receptor Superfamily member 5; Bp50; CD40L Receptor; CDw40; TNFRSF5
AA Sequence

MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Molecular Weight

Approximately 47.7 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD40 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P72909
Quantity:
MCE Japan Authorized Agent: