1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD28
  5. CD28 Protein, Rat (HEK293, His)

CD28 Protein activates T-cells, promoting cell proliferation, cytokine production, and T-cell survival. It collaborates with TCR/CD3 ligation and CD40L costimulation to boost IL4 and IL10 production in T-cells. CD28 Protein forms a disulfide-linked homodimer and interacts with DUSP14. It also binds to CD80/B7-1 and CD86/B7-2/B70, and interacts with GRB2 (By similarity). CD28 Protein, Rat (HEK293, His) is the recombinant rat-derived CD28 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD28 Protein activates T-cells, promoting cell proliferation, cytokine production, and T-cell survival. It collaborates with TCR/CD3 ligation and CD40L costimulation to boost IL4 and IL10 production in T-cells. CD28 Protein forms a disulfide-linked homodimer and interacts with DUSP14. It also binds to CD80/B7-1 and CD86/B7-2/B70, and interacts with GRB2 (By similarity). CD28 Protein, Rat (HEK293, His) is the recombinant rat-derived CD28 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD28 Protein plays a crucial role in T-cell activation by inducing cell proliferation, cytokine production, and promoting T-cell survival. It works in conjunction with TCR/CD3 ligation and CD40L costimulation to enhance the production of IL4 and IL10 in T-cells. CD28 Protein forms a homodimer through disulfide-linkage and interacts with DUSP14. Additionally, it binds to CD80/B7-1 and CD86/B7-2/B70, and has an interaction with GRB2 (By similarity).

Biological Activity

Immobilized Recombinant Human B7-2 Protein at 2 μg/mL (100 μL/well) can bind Recombinant Rat CD28 Protein. The ED50 for this effect is 955.5 ng/mL.

  • Immobilized Recombinant Human B7-2 Protein at 2 μg/mL (100 μL/well) can bind Recombinant Rat CD28 Protein. The ED50 for this effect is 955.5 ng/mL.
Species

Rat

Source

HEK293

Tag

C-His

Accession

P31042 (N20-K149)

Gene ID
Molecular Construction
N-term
CD28 (N20-K149)
Accession # P31042
His
C-term
Protein Length

Extracellular Domain

Synonyms
CD28; T-cell-specific surface glycoprotein CD28; Tp44
AA Sequence

NKILVKQSPLLVVDNNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRPNVGFNCDGNFDNETVTFRLWNLDVNHTDIYFCKIEVMYPPPYLDNEKSNGTIIHIKEKHLCHAQTSPK

Molecular Weight

The protein migrates as approximately 30-36 kDa under reducing SDS-PAGE due to glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD28 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74309
Quantity:
MCE Japan Authorized Agent: