CD28 Protein, Rat (HEK293, His)

CD28 Protein activates T-cells, promoting cell proliferation, cytokine production, and T-cell survival. It collaborates with TCR/CD3 ligation and CD40L costimulation to boost IL4 and IL10 production in T-cells. CD28 Protein forms a disulfide-linked homodimer and interacts with DUSP14. It also binds to CD80/B7-1 and CD86/B7-2/B70, and interacts with GRB2 (By similarity). CD28 Protein, Rat (HEK293, His) is the recombinant rat-derived CD28 protein, expressed by HEK293 , with C-His labeled tag.

CD28 Protein plays a crucial role in T-cell activation by inducing cell proliferation, cytokine production, and promoting T-cell survival. It works in conjunction with TCR/CD3 ligation and CD40L costimulation to enhance the production of IL4 and IL10 in T-cells. CD28 Protein forms a homodimer through disulfide-linkage and interacts with DUSP14. Additionally, it binds to CD80/B7-1 and CD86/B7-2/B70, and has an interaction with GRB2 (By similarity).

Immobilized Recombinant Human B7-2 Protein at 2 μg/mL (100 μL/well) can bind Recombinant Rat CD28 Protein. The ED₅₀ for this effect is 955.5 ng/mL.

• 
  Immobilized Recombinant Human B7-2 Protein at 2 μg/mL (100 μL/well) can bind Recombinant Rat CD28 Protein. The ED₅₀ for this effect is 955.5 ng/mL.

Rat

HEK293

C-His

P31042 (N20-K149)

25660  [NCBI]

Extracellular Domain

NKILVKQSPLLVVDNNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRPNVGFNCDGNFDNETVTFRLWNLDVNHTDIYFCKIEVMYPPPYLDNEKSNGTIIHIKEKHLCHAQTSPK

The protein migrates as approximately 30-36 kDa under reducing SDS-PAGE due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.