1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin E
  5. Cathepsin E Protein, Human (HEK293, His)

Cathepsin E Protein, Human (HEK293, His) is a human cathepsin E with a His tag. Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Cathepsin E Protein, Human (HEK293, His) is a human cathepsin E with a His tag. Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases.[1].

Background

Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases. As an intracellular, hydrolytic aspartic protease, Cathepsin E is mainly expressed in cells of the immune and gastrointestinal systems, lymphoid tissues, erythrocytes, and cancer cells[1].
Cathepsin E functions by breaking down proteins through the hydrolysis of peptide bonds at a specific peptide sequence site. And Cathepsin E plays an important role in the degradation of proteins, the generation of bioactive proteins, and antigen processing[2].
Human Cathepsin E is synthesized as a precursor protein, consisting of a signal peptide (residues 117), a propeptide (residues 1853), and a mature chain (residues 54396)[3].

Biological Activity

Measured by its ability to cleave 40μM fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2 that incubated at room temperature for 30min. The specific activity is 14784.79 pmol/min/ug.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P14091 (S20-P396)

Gene ID
Molecular Construction
N-term
Cathepsin E (S20-P396)
Accession # P14091
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuCathepsin E, His; Cathepsin E; CTSE
AA Sequence

SLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVPHHHHHH

Molecular Weight

Approximately 42-48 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.    

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Cathepsin E Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin E Protein, Human (HEK293, His)
Cat. No.:
HY-P7750
Quantity:
MCE Japan Authorized Agent: