1. Recombinant Proteins
  2. CAR-T Related Proteins Biotinylated Proteins
  3. CA-125
  4. CA125 Protein, Human (Biotinylated, HEK293, Fc-Avi)

CA125 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P72347
Handling Instructions Technical Support

The CA125 protein acts by binding to MSLN and plays a crucial role in forming a protective and lubricating barrier on mucosal surfaces. This interaction promotes heterotypic cell adhesion and is suggested to play an important role in peritoneal metastasis of ovarian cancer. CA125 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived CA125 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CA125 protein acts by binding to MSLN and plays a crucial role in forming a protective and lubricating barrier on mucosal surfaces. This interaction promotes heterotypic cell adhesion and is suggested to play an important role in peritoneal metastasis of ovarian cancer. CA125 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived CA125 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

Background

CA125 protein is believed to serve a crucial role in establishing a protective and lubricating barrier against particles and infectious agents at mucosal surfaces. It exerts its functions through binding to MSLN, where the interaction mediates heterotypic cell adhesion. This adhesive property may play a significant role in the metastasis of ovarian cancer to the peritoneum, as CA125 initiates cell attachment to the mesothelial epithelium by binding to MSLN. The interaction between CA125 and MSLN underscores its potential involvement in the adhesive events associated with cancer metastasis, particularly in the context of ovarian cancer progression to the peritoneal cavity.

Species

Human

Source

HEK293

Tag

C-Avi;C-hFc

Accession

Q8WXI7 (G12660-M12923)

Gene ID
Molecular Construction
N-term
CA125 (G12660-M12923)
Accession # Q8WXI7
hFc-Avi
C-term
Protein Length

Partial

Synonyms
CA125 ovarian cancer antigen; CA-125; FLJ14303; MUC16
AA Sequence

GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM

Molecular Weight

80-120 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CA125 Protein, Human (Biotinylated, HEK293, Fc-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CA125 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P72347
Quantity:
MCE Japan Authorized Agent: