1. Recombinant Proteins
  2. Cytokines and Growth Factors Others
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. Bone Morphogenetic Protein 3 (BMP-3/Osteogenin)
  6. BMP-3 Protein, Human

BMP-3 Protein, a TGF-beta superfamily member, crucially influences early skeletal formation and acts as a bone density negative regulator. It counteracts osteogenic BMPs, hindering osteoprogenitor differentiation. BMP-3 initiates signaling via ACVR2B, activating SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK. Structurally, it forms homodimers with disulfide bonds, interacting with ACVR2B to regulate functions. BMP-3 Protein, Human is the recombinant human-derived BMP-3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BMP-3 Protein, a TGF-beta superfamily member, crucially influences early skeletal formation and acts as a bone density negative regulator. It counteracts osteogenic BMPs, hindering osteoprogenitor differentiation. BMP-3 initiates signaling via ACVR2B, activating SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK. Structurally, it forms homodimers with disulfide bonds, interacting with ACVR2B to regulate functions. BMP-3 Protein, Human is the recombinant human-derived BMP-3 protein, expressed by E. coli , with tag free.

Background

BMP-3 Protein, a member of the TGF-beta superfamily, plays a crucial role in developmental processes, particularly in inducing and patterning early skeletal formation, while concurrently acting as a negative regulator of bone density. Notably, it counteracts the osteogenic BMPs' ability to induce osteoprogenitor differentiation and ossification. The initiation of signaling cascades involves BMP-3 associating with the type II receptor ACVR2B, activating both SMAD2-dependent and SMAD-independent pathways, including TAK1 and JNK pathways. Structurally, BMP-3 exists as a homodimer linked by disulfide bonds and interacts with the type II receptor ACVR2B to exert its regulatory functions.

Biological Activity

Measured by its ability to inhibit BMP-2-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. 30 µg/mL of hBMP-3 will antagonize hBMP-2 (0.25 µg/mL) induction of alkaline phosphatase in MC3T3E1 cells by 52.83%.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P12645 (Q363-R472)

Gene ID

651  [NCBI]

Molecular Construction
N-term
BMP-3 (Q363-R472)
Accession # P12645
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Bone Morphogenetic Protein 3; Osteogenin; Bone Morphogenetic Protein 3 (Osteogenic); Bone Morphogenetic Protein 3A; BMP-3A; BMP3A; BMP-3
AA Sequence

QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR

Molecular Weight

Approximately 12 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMP-3 Protein, Human
Cat. No.:
HY-P79077
Quantity:
MCE Japan Authorized Agent: