1. Recombinant Proteins
  2. Others
  3. BD-2 Protein, Human

BD-2 Protein, Human is an anti-microbial peptide that participates in the response to microbial invasion.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE BD-2 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

BD-2 Protein, Human is an anti-microbial peptide that participates in the response to microbial invasion.

Background

Human β-defensin-2 (HBD-2) is a potent anti-microbial peptide that is part of the innate immune response. HBD-2 is a natural anti-microbial peptide present in amniotic fluid participates in the host response to microbial invasion of the amniotic cavity[1]. Unlike hBD-1, this second peptide, human beta-defensin-2 (hBD-2), is regulated at a transcriptional level in response to contact with microorganisms, and is highly effective in killing Gram negative bacteria. Its expression is also up-regulated by the cytokine tumor necrosis factor-alpha[2].

Biological Activity

1.Full biological activity determined by a chemotaxis bioassay using immature human dendritic cells is in a concentration range of 10-100 ng/mL.
2.Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 65.46 ng/mL, corresponding to a specific activity is 1.528×104U/mg.
3.Measured by its ability to chemoattract immature human dendritic cells. The ED50 for this effect is 65.16 ng/mL, corresponding to a specific activity is 1.535×104 U/mg.

  • Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 65.46 ng/mL, corresponding to a specific activity is 1.528×104 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

O15263 (G24-P64)

Gene ID
Molecular Construction
N-term
BD-2 (G24-P64)
Accession # O15263
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuBD-2; DEFB2
AA Sequence

GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Molecular Weight

Approximately 4.3-9 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PBS, pH 7.4, 130 mM NaCl or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

BD-2 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BD-2 Protein, Human
Cat. No.:
HY-P7135
Quantity:
MCE Japan Authorized Agent: