1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. APT-1/LYPLA1 Protein, Human (His)

The APT-1/LYPLA1 protein is an acylprotein thioesterase that hydrolyzes fatty acids from S-acylated cysteine residues in proteins, including G alpha proteins and HRAS. It also depalmitoylates KCNMA1 and potentially ADRB2 while acting as a lysophospholipase, hydrolyzing lysophosphatidylcholine (lyso-PC) and other lysophospholipids (lyso-PE, lyso-PI, lyso-PS). APT-1/LYPLA1 Protein, Human (His) is the recombinant human-derived APT-1/LYPLA1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The APT-1/LYPLA1 protein is an acylprotein thioesterase that hydrolyzes fatty acids from S-acylated cysteine residues in proteins, including G alpha proteins and HRAS. It also depalmitoylates KCNMA1 and potentially ADRB2 while acting as a lysophospholipase, hydrolyzing lysophosphatidylcholine (lyso-PC) and other lysophospholipids (lyso-PE, lyso-PI, lyso-PS). APT-1/LYPLA1 Protein, Human (His) is the recombinant human-derived APT-1/LYPLA1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

APT-1/LYPLA1 protein functions as an acyl-protein thioesterase, catalyzing the hydrolysis of fatty acids from S-acylated cysteine residues within proteins, including trimeric G alpha proteins and HRAS. Additionally, it exhibits depalmitoylating activity towards KCNMA1 and potentially ADRB2. Acting as a lysophospholipase, APT-1/LYPLA1 hydrolyzes lysophosphatidylcholine (lyso-PC) and other lysophospholipids such as lyso-PE, lyso-PI, and lyso-PS, with a higher affinity for thioesterase activity. This protein significantly contributes to blood coagulation by recognizing and cleaving plasma phospholipids, generating lysophospholipids that serve as substrates for ENPP2, ultimately producing lysophosphatidic acid (LPA).

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O75608 (M1-D230)

Gene ID
Molecular Construction
N-term
6*His
APT-1 (M1-D230)
Accession # O75608
C-term
Protein Length

Full Length

Synonyms
rHuAPT-1, His; LYPLA1; APT-1
AA Sequence

MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPIDHHHHHH

Molecular Weight

Approximately 25.0 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filter solution of 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 10% Glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

APT-1/LYPLA1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
APT-1/LYPLA1 Protein, Human (His)
Cat. No.:
HY-P7539
Quantity:
MCE Japan Authorized Agent: