1. Recombinant Proteins
  2. Others
  3. Apolipoprotein A-I/APOA1 Protein, Mouse (246a.a, HEK293, Fc)

Apolipoprotein A-I/APOA1 Protein, Mouse (246a.a, HEK293, Fc)

Cat. No.: HY-P72833
Handling Instructions Technical Support

The apolipoprotein AI (APOA1) protein is key to reverse cholesterol transport, promoting tissue efflux, and serves as an important cofactor for lecithin cholesterol acyltransferase (LCAT), promoting cholesterol excretion. As a homodimer, APOA1 is a component of the sperm activating protein complex (SPAP), interacts with APOA1BP, CLU, NDRG1, SCGB3A2, NAXE and YJEFN3, exhibiting multiple molecular associations. Apolipoprotein A-I/APOA1 Protein, Mouse (246a.a, HEK293, Fc) is the recombinant mouse-derived Apolipoprotein A-I/APOA1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
200 μg Get quote
> 200 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The apolipoprotein AI (APOA1) protein is key to reverse cholesterol transport, promoting tissue efflux, and serves as an important cofactor for lecithin cholesterol acyltransferase (LCAT), promoting cholesterol excretion. As a homodimer, APOA1 is a component of the sperm activating protein complex (SPAP), interacts with APOA1BP, CLU, NDRG1, SCGB3A2, NAXE and YJEFN3, exhibiting multiple molecular associations. Apolipoprotein A-I/APOA1 Protein, Mouse (246a.a, HEK293, Fc) is the recombinant mouse-derived Apolipoprotein A-I/APOA1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Apolipoprotein A-I (APOA1) Protein plays a pivotal role in the reverse transport of cholesterol, facilitating its efflux from tissues and functioning as a crucial cofactor for lecithin cholesterol acyltransferase (LCAT) to promote cholesterol excretion from tissues to the liver. This protein exists as a homodimer and is part of the sperm activating protein complex (SPAP), which includes APOA1, an immunoglobulin heavy chain, an immunoglobulin light chain, and albumin. APOA1 also interacts with APOA1BP and CLU, contributing to its diverse molecular associations. Additionally, it engages with NDRG1, SCGB3A2, NAXE, and YJEFN3, further highlighting its involvement in various cellular processes beyond cholesterol metabolism, including spermatozoa motility and protein complex interactions.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse APOA1 at 5 μg/ml (100 μl/well) can bind biotinylated Human MSRI. The ED50 for this effect is 0.7815 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse Apolipoprotein A-I/ApoA1 at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human MSRI (SR-AI/MSR).The ED50 for this effect is 624.2 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q00623 (W19-Q264)

Gene ID
Molecular Construction
N-term
APOA1 (W19-Q264)
Accession # Q00623
hFc
C-term
Synonyms
Apolipoprotein A-I; Apo-AI; ProapoA-I; APOA1
AA Sequence

WHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ

Molecular Weight

Approximately 58 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Apolipoprotein A-I/APOA1 Protein, Mouse (246a.a, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein A-I/APOA1 Protein, Mouse (246a.a, HEK293, Fc)
Cat. No.:
HY-P72833
Quantity:
MCE Japan Authorized Agent: