1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. IGF family
  4. Insulin-like Growth Factor I (IGF-1)
  5. Animal-Free IGF-I Protein, Pig (His)

The IGF-I protein is structurally similar to insulin and has excellent growth-promoting activity. As a potential physiological regulator, it affects [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Animal-Free IGF-I Protein, Pig (His) is the recombinant pig-derived animal-FreeIGF-I protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IGF-I protein is structurally similar to insulin and has excellent growth-promoting activity. As a potential physiological regulator, it affects [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Animal-Free IGF-I Protein, Pig (His) is the recombinant pig-derived animal-FreeIGF-I protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

The IGF-I protein, sharing structural and functional similarities with insulin, surpasses its counterpart in growth-promoting activity. It potentially acts as a physiological regulator, influencing [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Demonstrating efficacy in stimulating glucose transport in bone-derived osteoblastic (PyMS) cells at significantly lower concentrations than insulin, IGF-I extends its impact to glycogen and DNA synthesis, as well as enhanced glucose uptake. With a potential role in synapse maturation, IGF-I is implicated in Ca(2+)-dependent exocytosis essential for sensory perception of smell in the olfactory bulb. Functioning as a ligand for IGF1R, it binds to the alpha subunit, initiating the activation of intrinsic tyrosine kinase activity, leading to a cascade of downstream signaling events, including the activation of the PI3K-AKT/PKB and Ras-MAPK pathways. Essential for IGF1 signaling, IGF-I forms crucial ternary complexes with integrins (ITGAV:ITGB3 and ITGA6:ITGB4) and IGFR1, influencing the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2, and AKT1.

Species

Pig

Source

E. coli

Tag

C-6*His

Accession

P16545 (G49-A118)

Gene ID
Molecular Construction
N-term
IGF-I (G49-A118)
Accession # P16545
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Insulin-like growth factor I; IGF-I; MGF; Somatomedin-C; IBP1
AA Sequence

MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Predicted Molecular Mass
9.4 kDa
Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IGF-I Protein, Pig (His)
Cat. No.:
HY-P700241AF
Quantity:
MCE Japan Authorized Agent: