1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-6
  6. Animal-Free BMP-6 Protein, Human (His)

BMP-6 protein is a member of the TGF-β superfamily and is critical in various developmental processes including skeletal development. It acts as a key regulator of HAMP/hepcidin expression and iron metabolism via hemojuvelin/HJV. Animal-Free BMP-6 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Animal-Free BMP-6 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BMP-6 protein is a member of the TGF-β superfamily and is critical in various developmental processes including skeletal development. It acts as a key regulator of HAMP/hepcidin expression and iron metabolism via hemojuvelin/HJV. Animal-Free BMP-6 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

BMP-6 Protein, a member of the TGF-beta superfamily, is indispensable in various developmental processes, including cartilage and bone formation. Beyond its roles in skeletal development, BMP-6 serves as a crucial regulator of HAMP/hepcidin expression and iron metabolism by acting as a ligand for hemojuvelin/HJV. Moreover, it can promote HAMP expression, potentially through interaction with its receptor BMPR1A/ALK3. The initiation of the canonical BMP signaling cascade involves BMP-6 associating with the type I receptor ACVR1 and type II receptor ACVR2B, with ACVR1 propagating signals by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Additionally, BMP-6 can engage non-canonical pathways, such as the TAZ-Hippo signaling cascade, influencing VEGF signaling by regulating VEGFR2 expression. It forms interactions with various proteins, including SOSTDC1, Hemojuvelin/HJV, ERFE, and BMPR1A/ALK3, showcasing its versatile regulatory roles in different cellular processes.

Biological Activity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <87 ng/mL

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P22004 (V397-H513)

Gene ID

654  [NCBI]

Molecular Construction
N-term
BMP-6 (V397-H513)
Accession # P22004
6*His
C-term
Protein Length

Partial

Synonyms
Bone morphogenetic protein 6; Bmp6; BMP-6; VG-1-related protein; VGR-1; Vgr1
AA Sequence

MVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH

Predicted Molecular Mass
14.1 kDa
Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5 or PBS, pH 8.0.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free BMP-6 Protein, Human (His)
Cat. No.:
HY-P700029AF
Quantity:
MCE Japan Authorized Agent: