1. Neuronal Signaling
  2. Amyloid-β
  3. β-Amyloid (1-40), HFIP-treated TFA

β-Amyloid (1-40), HFIP-treated is a β-Amyloid (1-40) (HY-P0265A) treated with HFIP. β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Amyloid (1-40), HFIP-treated TFA

β-Amyloid (1-40), HFIP-treated TFA Chemical Structure

Size Price Stock
1 mg Ask For Quote & Lead Time
1 mg * 5 Ask For Quote & Lead Time

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of β-Amyloid (1-40), HFIP-treated TFA:

Other Forms of β-Amyloid (1-40), HFIP-treated TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Amyloid (1-40), HFIP-treated is a β-Amyloid (1-40) (HY-P0265A) treated with HFIP. β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease[1].

In Vivo

Note:
Please do not refer to only one article to determine the experimental conditions. It is recommended to determine the optimal experimental conditions (animal strain, age, dosage, frequency and cycle, detection time and indicators, etc.) through preliminary experiments before the formal experiment.

β-Amyloid (1-40) can be used in animal modeling to create Alzheimer's disease models.

Induction of Alzheimer's disease[2]
Background
β-Amyloid (1-40) induces Alzheimer's disease by accumulating in the brain and being neurotoxic.
Specific Modeling Methods
Rat: Wistar • male • 280-320 g
Administration: 0, 3, 30, 300 pmol • connection of cannulae to modified micro-osmotic pumps for infusion • 2 weeks
Note
(1) Dissolve β-Amyloid (1-40) in 35% acetonitrile/0.1% trifluoroacetic acid (TFA).
(2) In each group of 7 rats, a catheter was placed into the left ventricle on day 1. A water maze task was performed on days 9-13 after the start of infusion. At the end of the behavioural experiments, 4 rats from each group were taken from each group and processed by severing their heads for ChAT activity assay. Three rats were taken for histochemical studies.
(3) In histochemical studies, rats were anaesthetised and executed by transaortic perfusion fixation, first in cold saline and then in 4% paraformaldehyde and 0.1 M sodium phosphate buffer. Brains were removed and fixed in the same fixative for 12 hours. Frozen brain tissue was cut at 20 μm using a cryostat and the periventricular region was collected.
Modeling Indicators
Molecular changes: The activity of acetyltransferase (ChAT) in the frontal cortex and hippocampus is reduced, and cholinergic neuron dysfunction occurs.
Organizational changes: Accumulation of β-Amyloid in the hippocampus and cerebral cortex.
Phenotypic observation: Memory impairment occurs.
Correlated Product(s): /
Opposite Product(s): /

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4329.80 (free base)

Formula

C194H295N53O58S.xC2HF3O2

Appearance

Oil

Color

Colorless to light yellow

Sequence

Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Sequence Shortening

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Pure form -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Amyloid (1-40), HFIP-treated TFA
Cat. No.:
HY-P0265C
Quantity:
MCE Japan Authorized Agent: