2. GPCR/G Protein
  3. CRFR
  4. Urocortin III (human) TFA

Urocortin III (human) TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III (human) TFA preferentially binds and activates CRF-R2 and has a discrete central nervous system and peripheral distribution. Urocortin III (human) TFA potently binds to type 2 CRF receptors, specifically mCRF2β (Ki = 13.5 nM) and rCRF2α (Ki = 21.7 nM), while demonstrating negligible affinity for hCRF1 (Ki >100 nM). Urocortin III (human) TFA mediates somatostatin-dependent negative feedback control of Insulin (human) (HY-P0035) secretion[1][2].

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Urocortin III (human) TFA

Urocortin III (human) TFA Chemical Structure

Size Price Stock Quantity
500 μg Get quote 3 - 4 weeks 4 - 5 weeks 2 - 3 weeks
1 mg Get quote 3 - 4 weeks 4 - 5 weeks 2 - 3 weeks
5 mg   Get quote  
10 mg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Urocortin III (human) TFA:

Urocortin III (human) TFA Related Antibodies

Top Publications Citing Use of Products

View All CRFR Isoform Specific Products:

View All Isoforms
CRFR1 CRFR2

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Urocortin III (human) TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III (human) TFA preferentially binds and activates CRF-R2 and has a discrete central nervous system and peripheral distribution. Urocortin III (human) TFA potently binds to type 2 CRF receptors, specifically mCRF2β (Ki = 13.5 nM) and rCRF2α (Ki = 21.7 nM), while demonstrating negligible affinity for hCRF1 (Ki >100 nM). Urocortin III (human) TFA mediates somatostatin-dependent negative feedback control of Insulin (human) (HY-P0035) secretion[1][2].

IC50 & Target[1]

mCRF2β

13.5 nM (Ki)

rCRF2α

21.7 nM (Ki)

In Vitro

Urocortin III (human) (0.001-1000 nM, 20 min) FTA induces intracellular cAMP accumulation in CHO cells stably expressing murine CRF-R2[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Urocortin III (human) TFA Related Antibodies
Molecular Weight

4137.87 (free base)

Formula

C185H307N53O50S2.xC2HF3O2
Sequence

Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2
Sequence Shortening

FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Urocortin III (human) TFA Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Urocortin III (human)CRFRCorticotropin-releasing Factor ReceptorCRHRcorticotropin-releasing factorcentral nervous systeminsulinperipheralsomatostatin-dependentInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Urocortin III (human) TFA
Cat. No.:
HY-P3019A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.