Search Result
Results for "
mimicking
" in MedChemExpress (MCE) Product Catalog:
99
Biochemical Assay Reagents
1
Isotope-Labeled Compounds
Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-P5558
-
|
VEGFR
|
Inflammation/Immunology
|
KLTWQELYQLKYKGI (QK) is a VEGF mimicking peptide, binds to the VEGF receptors and competes with VEGF. KLTWQELYQLKYKGI is active in gastric ulcer healing in rodents when administered either orally or systemically. KLTWQELYQLKYKGI shows the ability to induce capillary formation and organization in vitro .
|
-
-
- HY-P1416
-
|
Wnt
|
Cancer
|
Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .
|
-
-
- HY-P1416A
-
|
Wnt
|
Cancer
|
Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .
|
-
-
- HY-P0102
-
|
mAChR
|
Neurological Disease
|
Dipeptide diaminobutyroyl benzylamide diacetate, a Wagerlin-1-mimicking peptide, is a mAChR antagonist. Dipeptide diaminobutyroyl benzylamide diacetate can induce muscle relaxation .
|
-
-
- HY-112416
-
AZD4320
2 Publications Verification
|
Bcl-2 Family
|
Cancer
|
AZD4320 is a novel BH3-mimicking dual BCL2/BCLxL inhibitor with IC50s of 26 nM, 17 nM, and 170 nM for KPUM-MS3, KPUM-UH1, and STR-428 cells, respectively.
|
-
-
- HY-17551
-
NMDA
Maximum Cited Publications
22 Publications Verification
N-Methyl-D-aspartic acid
|
iGluR
Endogenous Metabolite
|
Neurological Disease
|
NMDA is a specific agonist for NMDA receptor mimicking the action of glutamate, the neurotransmitter which normally acts at that receptor.
|
-
-
- HY-P10428
-
|
HPV
|
Infection
|
E6AP-mimicking peptide (compound 13) is a high-affinity, selective, irreversible and potent peptide-based covalent HPV16 E6 inhibitor targeting the 16E6 oncoprotein using a cysteine-reactive acrylamide warhead. E6AP-mimicking peptide has a Ki of 17 nM. E6AP-mimicking peptide targets all residues appearing in the binding pocket of E6 to disrupt the binding interface of 16E6 and E6AP. E6AP-mimicking peptide selectively binds and crosslinks to MBP-16E6 in PBS or a protein mixture .
|
-
-
- HY-P5171
-
|
Wnt
|
Cancer
|
MDGCEL is a WNT5A peptide, that acts as a WNT5A mimicks and exhibits WNT5A antagonistic activity .
|
-
-
- HY-167815
-
|
Biochemical Assay Reagents
|
|
Myo-Inositol hexasulfate hexapotassium is a sulfated derivative of inositol that has the activity of mimicking highly sulfated polysaccharides such as heparin, affecting many cell signaling pathways.
|
-
-
- HY-158464
-
|
Biochemical Assay Reagents
|
Others
|
Fetuin glycoprotein is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158466
-
|
Biochemical Assay Reagents
|
Others
|
Human IgG Glycoprotein is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-P10026
-
LY-3457263
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
Nisotirotide (LY-3457263) is a subcutaneous injectable NPY2 receptor agonist. By mimicking peptide YY (PYY), Nisotirotide inhibits appetite and can be used in the research of diseases such as obesity and diabetes .
|
-
-
- HY-158528
-
A3 N-linked oligosaccharide
|
Biochemical Assay Reagents
|
Others
|
A3 glycan (A3 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158532
-
A4 N-linked oligosaccharide
|
Biochemical Assay Reagents
|
Others
|
A4 glycan (A4 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-W142596
-
|
Liposome
|
Others
|
1,2-DImyristoyl-rac-glycero-3-phosphocholine (DMPC), a zwitterionic phospholipid, is chosen as a simple eukaryotic cell membrane, mimicking the neutral charge of the surface membrane of eukaryotic plasma membranes .
|
-
-
- HY-158494
-
A2 N-linked oligosaccharide
|
Biochemical Assay Reagents
|
Others
|
A2 glycan (G0) (A2 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158460
-
Galactose-alpha-1,3-galactose
|
Biochemical Assay Reagents
|
Others
|
Alpha-Gal (Galactose-alpha-1,3-galactose) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158490
-
A4G4 N-linked oligosaccharide
|
Biochemical Assay Reagents
|
Others
|
A4G4 glycan (A4G4 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158542
-
A4 N-linked oligosaccharide, procainamide labelled
|
Biochemical Assay Reagents
|
Others
|
A4 glycan, procainamide labelled (A4 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158531
-
A3 N-linked oligosaccharide, procainamide labelled
|
Fluorescent Dye
Biochemical Assay Reagents
|
Others
|
A3 glycan, procainamide labelled (A3 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158472
-
|
Biochemical Assay Reagents
|
Others
|
Sialylated Core 1 O-glycan (C1S(3)1) () is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158534
-
Mannose-8 N-linked oligosaccharide; Oligomannose 8 glycan
|
Biochemical Assay Reagents
|
Others
|
M8 glycan (Man8) (Mannose-8 N-linked oligosaccharide; Oligomannose 8 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158493
-
A2 N-linked oligosaccharide, procainamide labelled
|
Biochemical Assay Reagents
|
Others
|
A2 glycan (G0), procainamide labelled (A2 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158463
-
|
Biochemical Assay Reagents
|
Others
|
A2G2S2-KVANKT glycopeptide is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158509
-
Mannose-6 N-linked oligosaccharide; Oligomannose 6 glycan
|
Biochemical Assay Reagents
|
Others
|
M6 glycan (Man6) (Mannose-6 N-linked oligosaccharide; Oligomannose 6 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158497
-
A2 N-linked oligosaccharide, APTS labelled
|
Biochemical Assay Reagents
|
Others
|
A2 glycan (G0), APTS labelled (A2 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158485
-
Mannose-5 N-linked oligosaccharide; Oligomannose 5 glycan
|
Biochemical Assay Reagents
|
Others
|
M5 glycan (Man5) (Mannose-5 N-linked oligosaccharide; Oligomannose 5 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-P991337
-
-
-
- HY-158519
-
Mannose-7 N-linked oligosaccharide; Oligomannose 7 glycan
|
Biochemical Assay Reagents
|
Others
|
M7 glycan (Man7) (Mannose-7 N-linked oligosaccharide; Oligomannose 7 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158543
-
Mannose-9 N-linked oligosaccharide; Oligomannose 9 glycan
|
Biochemical Assay Reagents
|
Others
|
M9 glycan (Man9) (Mannose-9 N-linked oligosaccharide; Oligomannose 9 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158482
-
Mannose-3 N-linked oligosaccharide; Oligomannose 3 glycan
|
Biochemical Assay Reagents
|
Others
|
M3 glycan (Man3) (Mannose-3 N-linked oligosaccharide; Oligomannose 3 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-119274
-
|
COX
Sodium Channel
|
Neurological Disease
|
BN-82451 dihydrochloride, an orally active and CNS-penetrated antioxidant and a multitargeting neuroprotective agent, exert a significant protection in experimental animal models mimicking aspects of cerebral ischemia, Parkinson disease, Huntington disease, and more particularly amyotrophic lateral sclerosis .
|
-
-
- HY-158516
-
Mannose-6 N-linked oligosaccharide, procainamide labelled; Oligomannose 6 glycan, procainamide labelled
|
Biochemical Assay Reagents
|
Others
|
M6 glycan (Man6), procainamide labelled (Mannose-6 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158541
-
A4 N-linked oligosaccharide, 2-AB labelled
|
Fluorescent Dye
Biochemical Assay Reagents
|
Others
|
A4 glycan, 2-AB labelled (A4 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158540
-
A4 N-linked oligosaccharide, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
A4 glycan, 2-AA labelled (A4 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-162467
-
|
Proton Pump
|
Others
|
Opabactin is an agonist for abscisic acid (ABA) receptor, which regulates the water use of plants by mimicking the effects of ABA with an IC50 of 7 nM. Opabactin inhibits the seed germination of Arabidopsis with an IC50 of 62 nM. Opabactin induces anti-transpiration response in plant tissue, and improves crop drought tolerance .
|
-
-
- HY-158468
-
|
Biochemical Assay Reagents
|
Others
|
Sialylated Core 1 O-glycan (C1S(3)1), 2AB labelled () is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158529
-
A3 N-linked oligosaccharide, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
A3 glycan, 2-AA labelled (A3 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158530
-
A3 N-linked oligosaccharide, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
A3 glycan, 2-AB labelled (A3 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158498
-
FA2 N-linked oligosaccharide; F(6)A2 glycan
|
Biochemical Assay Reagents
|
Others
|
FA2 glycan (G0F) (FA2 N-linked oligosaccharide; F(6)A2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158496
-
A2 N-linked oligosaccharide, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
A2 glycan (G0), 2-AB labelled (A2 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-B0867
-
|
Herbicide
|
Others
|
2,4-D Butyl ester is an organic phenoxy herbicide and used to control woody broad-leaf weeds. 2,4-D butyl ester produces its herbicidal effect by mimicking natural plant growth hormones causing plants to grow too rapidly to survive .
|
-
-
- HY-158446
-
A2G2 N-linked oligosaccharide, APTS labelled
|
Biochemical Assay Reagents
|
Others
|
A2G2 glycan (G2), APTS labelled (A2G2 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158461
-
Galactose-alpha-1,3-galactose, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
Alpha-Gal standard, 2-AA labelled (Galactose-alpha-1,3-galactose, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158462
-
Galactose-alpha-1,3-galactose, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
Alpha-Gal standard, 2-AB labelled (Galactose-alpha-1,3-galactose, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158537
-
A3G3S3 N-linked oligosaccharide, procainamide labelled
|
Biochemical Assay Reagents
|
Others
|
A3G3S3 glycan, procainamide labelled (A3G3S3 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158491
-
A4G4 N-linked oligosaccharide, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
A4G4 glycan, 2-AA labelled (A4G4 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158492
-
A4G4 N-linked oligosaccharide, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
A4G4 glycan, 2-AB labelled (A4G4 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158539
-
Mannose-8 N-linked oligosaccharide, procainamide labelled; Oligomannose 8 glycan, procainamide labelled
|
Biochemical Assay Reagents
|
Others
|
M8 glycan (Man8), procainamide labelled (Mannose-8 N-linked oligosaccharide, procainamide labelled; Oligomannose 8 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
-
- HY-158546
-
Mannose-9 N-linked oligosaccharide, procainamide labelled; Oligomannose 9 glycan, procainamide labelled
|
Biochemical Assay Reagents
|
Others
|
M9 glycan (Man9), procainamide labelled (Mannose-9 N-linked oligosaccharide, procainamide labelled; Oligomannose 9 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158505
-
Mannose-5 N-linked oligosaccharide, APTS labelled; Oligomannose 5 glycan, APTS labelled
|
Biochemical Assay Reagents
|
Others
|
M5 glycan (Man5), APTS labelled (Mannose-5 N-linked oligosaccharide, APTS labelled; Oligomannose 5 glycan, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158526
-
Mannose-7 N-linked oligosaccharide, procainamide labelled; Oligomannose 7 glycan, procainamide labelled
|
Biochemical Assay Reagents
|
Others
|
M7 glycan (Man7), procainamide labelled (Mannose-7 N-linked oligosaccharide, procainamide labelled; Oligomannose 7 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158507
-
Mannose-5 N-linked oligosaccharide, procainamide labelled; Oligomannose 5 glycan, procainamide labelled
|
Biochemical Assay Reagents
|
Others
|
M5 glycan (Man5), procainamide labelled (Mannose-5 N-linked oligosaccharide, procainamide labelled; Oligomannose 5 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-D2361
-
|
Nucleoside Antimetabolite/Analog
|
Others
|
Adenosine 2'-PEG-Biotin is a biochemical reagent derived from adenosine. Adenosine 2'-PEG-Biotin regulates cell signaling pathways by mimicking the effects of endogenous adenosine and binding to its receptors. Adenosine 2'-PEG-Biotin can be used in the research of bioprobes, biosensors and diagnostic reagents .
|
-
- HY-158452
-
A3G3 N-linked oligosaccharide; A3G(4)3 glycan
|
Biochemical Assay Reagents
|
Others
|
A3G3 glycan (G3) (A3G3 N-linked oligosaccharide; A3G(4)3 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158465
-
F(3)A2 glycan-KVANKT & F(6)A2 glycan-KVANKT
|
Biochemical Assay Reagents
|
Others
|
GPEP FA2-KVANKT glycopeptide (F(3)A2 glycan-KVANKT & F(6)A2 glycan-KVANKT) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158488
-
A3G3 N-linked oligosaccharide, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
A3G3 glycan (G3), 2-AB labelled (A3G3 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158442
-
A2G2 N-linked oligosaccharide; A2G(4)2 glycan
|
Biochemical Assay Reagents
|
Others
|
A2G2 glycan (G2) (A2G2 N-linked oligosaccharide; A2G(4)2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158487
-
A3G3 N-linked oligosaccharide, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
A3G3 glycan (G3), 2-AA labelled (A3G3 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158445
-
A2G2 N-linked oligosaccharide, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
A2G2 glycan (G2), 2-AB labelled (A2G2 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158474
-
A2G2S1 N-linked oligosaccharide, APTS labelled
|
Biochemical Assay Reagents
|
Others
|
A2G2S1 glycan (G2S1), APTS labelled (A2G2S1 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-P5371
-
|
Thrombin
|
Others
|
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)
|
-
- HY-158527
-
FA2 N-linked oligosaccharide, APTS labelled; F(6)A2 glycan, APTS labelled
|
Biochemical Assay Reagents
|
Others
|
FA2 glycan (G0F), APTS labelled (FA2 N-linked oligosaccharide, APTS labelled; F(6)A2 glycan, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158448
-
FA2G2 N-linked oligosaccharide; F(6)A2G2
|
Biochemical Assay Reagents
|
Others
|
FA2G2 glycan (G2F) (FA2G2 N-linked oligosaccharide; F(6)A2G2) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158504
-
FA2G2S1 N-linked oligosaccharide, APTS labelled
|
Biochemical Assay Reagents
|
Others
|
FA2G2S1 glycan (G2FS1), APTS labelled (FA2G2S1 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158533
-
A3G3S3 N-linked oligosaccharide, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
A3G3S3 glycan, 2-AA labelled (A3G3S3 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158535
-
A3G3S3 N-linked oligosaccharide, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
A3G3S3 glycan, 2-AB labelled (A3G3S3 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158514
-
Mannose-6 N-linked oligosaccharide, 2-AB labelled; Oligomannose 6 glycan, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
M6 glycan (Man6), 2-AB labelled (Mannose-6 N-linked oligosaccharide, 2-AB labelled; Oligomannose 6 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158483
-
Mannose-3 N-linked oligosaccharide, 2-AA labelled; Oligomannose 3 glycan, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
M3 glycan (Man3), 2-AA labelled (Mannose-3 N-linked oligosaccharide, 2-AA labelled; Oligomannose 3 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-126039
-
|
Integrin
|
Cardiovascular Disease
|
L-739758 is an antagonist for αIIbβ3 integrin (platelet glycoprotein IIb/IIIa). L-739758 acts as a peptidomimetic, binds to αIIbβ3 integrin by mimicking the interaction of the RGD (arginine-glycine-aspartic acid) motif, and is involved in the blood coagulation process. L-739758 inhibits platelet aggregation, and is used for thrombosis research .
|
-
- HY-134263
-
|
PKA
Ras
|
Cardiovascular Disease
|
8-Br-cAMP-AM is a cyclic adenosine monophosphate (cAMP) analog that activates two major signal transduction pathways in the heart by mimicking the effects of cAMP: protein kinase A (PKA) and guanosine nucleotide exchange factor (Epac), which is directly activated by cAMP. 8-Br-cAMP-AM can be used to study cardiac ischemia and reperfusion injury .
|
-
- HY-158511
-
Mannose-6 N-linked oligosaccharide, 2-AA labelled; Oligomannose 6 glycan, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
M6 glycan (Man6), 2-AA labelled (Mannose-6 N-linked oligosaccharide, 2-AA labelled; Oligomannose 6 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158503
-
Mannose-5 N-linked oligosaccharide, 2-AB labelled; Oligomannose 5 glycan, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
M5 glycan (Man5), 2-AB labelled (Mannose-5 N-linked oligosaccharide, 2-AB labelled; Oligomannose 5 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158521
-
Mannose-7 N-linked oligosaccharide, 2-AA labelled; Oligomannose 7 glycan, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
M7 glycan (Man7), 2-AA labelled (Mannose-7 N-linked oligosaccharide, 2-AA labelled; Oligomannose 7 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158524
-
Mannose-7 N-linked oligosaccharide, 2-AB labelled; Oligomannose 7 glycan, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
M7 glycan (Man7), 2-AB labelled (Mannose-7 N-linked oligosaccharide, 2-AB labelled; Oligomannose 7 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158545
-
Mannose-9 N-linked oligosaccharide, 2-AB labelled; Oligomannose 9 glycan, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
M9 glycan (Man9), 2-AB labelled (Mannose-9 N-linked oligosaccharide, 2-AB labelled; Oligomannose 9 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158544
-
Mannose-9 N-linked oligosaccharide, 2-AA labelled; Oligomannose 9 glycan, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
M9 glycan (Man9), 2-AA labelled (Mannose-9 N-linked oligosaccharide, 2-AA labelled; Oligomannose 9 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158536
-
Mannose-8 N-linked oligosaccharide, 2-AA labelled; Oligomannose 8 glycan, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
M8 glycan (Man8), 2-AA labelled (Mannose-8 N-linked oligosaccharide, 2-AA labelled; Oligomannose 8 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158484
-
Mannose-3 N-linked oligosaccharide, 2-AB labelled; Oligomannose 3 glycan, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
M3 glycan (Man3), 2-AB labelled (Mannose-3 N-linked oligosaccharide, 2-AB labelled; Oligomannose 3 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158501
-
Mannose-5 N-linked oligosaccharide, 2-AA labelled; Oligomannose 5 glycan, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
M5 glycan (Man5), 2-AA labelled (Mannose-5 N-linked oligosaccharide, 2-AA labelled; Oligomannose 5 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158538
-
Mannose-8 N-linked oligosaccharide, 2-AB labelled; Oligomannose 8 glycan, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
M8 glycan (Man8), 2-AB labelled (Mannose-8 N-linked oligosaccharide, 2-AB labelled; Oligomannose 8 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158443
-
A2G2S1 N-linked oligosaccharide, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
A2G2S1 glycan (G2S1), 2-AB labelled (A2G2S1 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158502
-
FA2G2S1 N-linked oligosaccharide, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
FA2G2S1 glycan (G2FS1), 2-AB labelled (FA2G2S1 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158441
-
A2G2S1 N-linked oligosaccharide, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
A2G2S1 glycan (G2S1), 2-AA labelled (A2G2S1 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158447
-
A2G2 N-linked oligosaccharide, procainamide labelled; A2G(4)2 glycan, procainamide labelled
|
Biochemical Assay Reagents
|
Others
|
A2G2 glycan (G2), procainamide labelled (A2G2 N-linked oligosaccharide, procainamide labelled; A2G(4)2 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158486
-
FA2G2S1 N-linked oligosaccharide, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
FA2G2S1 glycan (G2FS1), 2-AA labelled (FA2G2S1 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158489
-
A3G3 N-linked oligosaccharide, procainamide labelled; A3G(4)3 glycan, procainamide labelled
|
Biochemical Assay Reagents
|
Others
|
A3G3 glycan (G3), procainamide labelled (A3G3 N-linked oligosaccharide, procainamide labelled; A3G(4)3 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158499
-
FA2 N-linked oligosaccharide, 2-AA labelled; F(6)A2 glycan, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
FA2 glycan (G0F), 2-AA labelled (FA2 N-linked oligosaccharide, 2-AA labelled; F(6)A2 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158500
-
FA2 N-linked oligosaccharide, 2-AB labelled; F(6)A2 glycan, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
FA2 glycan (G0F), 2-AB labelled (FA2 N-linked oligosaccharide, 2-AB labelled; F(6)A2 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-N11420
-
|
Bacterial
Phytohormone
|
Others
|
Coronatine is a plant growth regulator that mimicks the jasmonic acid-isoleucine conjugate (JA-Ile), targets the jasmonic acid receptor COI1, activates the jasmonic acid signaling pathway, thereby inhibiting salicylic acid (SA)-dependent defense responses. Coronatine antagonizes the stomatal closure, induces plant cell necrosis and chlorosis, interfers with plant hormone balance, thereby promoting pathogen infection .
|
-
- HY-P10356
-
|
TRP Channel
|
Others
|
T100-Mut is a cell-permeable peptide whose N-terminus is conjugated with a myristoylated group to enable T100-Mut to penetrate and localize to the inner side of the plasma membrane, thus mimicking the topology of Tmem100-3Q. T100-Mut can alleviate TRPA1-mediated pain .
|
-
- HY-158453
-
FA2B N-linked oligosaccharide, 2-AA labelled; G0F with bisecting GlcNAc, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
FA2B glycan (G0B), 2-AA labelled (FA2B N-linked oligosaccharide, 2-AA labelled; G0F with bisecting GlcNAc, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158451
-
FA2G2 N-linked oligosaccharide, APTS labelled; F(6)A2G2, APTS labelled
|
Biochemical Assay Reagents
|
Others
|
FA2G2 glycan (G2F), APTS labelled (FA2G2 N-linked oligosaccharide, APTS labelled; F(6)A2G2, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-P991069
-
|
HIV
|
Infection
|
VRC-01 is a fully human IgG1 antibody that targets envelope glycoprotein gp120 Protein. VRC-01 blocks viral entry by partially mimicking the interaction of the CD4 receptor with HIV-1 gp120 envelope glycoprotein. The isotype control for VRC-01 can refer to Human IgG1 kappa, Isotype Control (HY-P99001) .
|
-
- HY-N2466A
-
MT-I acetate; [Nle4,D-Phe7]-α-MSH acetate
|
Melanocortin Receptor
|
Cancer
|
Melanotan I acetate is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I acetate is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I acetate can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I acetate can be used for sunlight-induced skin cancers research .
|
-
- HY-158475
-
A2G2S1 N-linked oligosaccharide; A2G(4)2S(6)1 glycan
|
Biochemical Assay Reagents
|
Others
|
A2G2S1 glycan (G2S1) (A2G2S1 N-linked oligosaccharide; A2G(4)2S(6)1 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158506
-
A2G2S2 N-linked oligosaccharide; A2G(4)2S(6)2 glycan
|
Biochemical Assay Reagents
|
Others
|
A2G2S2 glycan (G2S2) (A2G2S2 N-linked oligosaccharide; A2G(4)2S(6)2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-116535B
-
|
Parasite
|
Infection
|
DL-threo-PPMP is an inhibitor of sphingosine synthetase in Plasmodium falciparum. DL-threo-PPMP inhibits the activity of sphingosine synthetase by mimicking the substrate sphingosine. This inhibition leads to a rapid decrease in the activity of sensitive sphingosine synthetase, selectively destroying the interconnected tubular network of TVMs in the host cell cytoplasm, and this inhibition also blocks the proliferation of Plasmodium falciparum. DL-threo-PPMP can be used for the study of Plasmodium biology and the search for new antimalarial strategies .
|
-
- HY-158513
-
FA2G2S2 N-linked oligosaccharide; F(6)A2G(4)2S(6)2 glycan
|
Biochemical Assay Reagents
|
Others
|
FA2G2S2 glycan (G2FS2) (FA2G2S2 N-linked oligosaccharide; F(6)A2G(4)2S(6)2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-P3431
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-B0867R
-
|
Herbicide
|
Others
|
2,4-D Butyl ester (Standard) is the analytical standard of 2,4-D Butyl ester. This product is intended for research and analytical applications. 2,4-D Butyl ester is an organic phenoxy herbicide and used to control woody broad-leaf weeds. 2,4-D butyl ester produces its herbicidal effect by mimicking natural plant growth hormones causing plants to grow too rapidly to survive .
|
-
- HY-129242
-
4-Oxo-Tempo
|
SOD
|
Others
|
Tempone (4-Oxo-Tempo) is a stable water-soluble nitro radical. Tempone is widely used as a contrast agent for metabolic activity and hypoxic sensitivity in electron spin resonance spectroscopy, magnetic resonance imaging and dynamic nuclear polarization. Tempone reduces superoxide radicals by mimicking the activity of superoxide dismutase (SOD), thereby reducing the formation of hydroxyl radicals and peroxynitrites. Tempone can be used in the study of ischemia-reperfusion injury and acute renal failure .
|
-
- HY-158450
-
FA2G2 N-linked oligosaccharide, 2-AB labelled; F(6)A2G2, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
FA2G2 glycan (G2F), 2-AB labelled (FA2G2 N-linked oligosaccharide, 2-AB labelled; F(6)A2G2, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-133813AR
-
|
Drug Metabolite
|
Neurological Disease
|
2,4-D Butyl ester (Standard) is the analytical standard of 2,4-D Butyl ester. This product is intended for research and analytical applications. 2,4-D Butyl ester is an organic phenoxy herbicide and used to control woody broad-leaf weeds. 2,4-D butyl ester produces its herbicidal effect by mimicking natural plant growth hormones causing plants to grow too rapidly to survive .
|
-
- HY-158473
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide
|
Biochemical Assay Reagents
|
Others
|
FA2[3]G1 & FA2[6]G1 glycan (G1F) (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-N2466
-
MT-I; [Nle4,D-Phe7]-α-MSH
|
Melanocortin Receptor
|
Neurological Disease
Cancer
|
Melanotan I is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I can be used for the research of sun-induced skin cancer, melanoma, inflammation and male erectile dysfunction .
|
-
- HY-116945
-
|
Endogenous Metabolite
|
Others
|
Diphenamid is a chemical compound that exhibits herbicide activity. Diphenamid acts by inhibiting the enzyme acetyl-CoA carboxylase. Diphenamid has shown resistance as a model for mimicking organic pollutants in wastewater treatment processes, especially in the presence of multiple anions. The degradation of diphenamid is significantly affected by certain inorganic ions, such as chromium (VI) and nitrogen oxides. Diphenamid shows changes in toxicity with longer treatment times, and the results of toxicity tests on selected algae indicate higher toxicity at 240 minutes of treatment .
|
-
- HY-158510
-
A2G2S2 N-linked oligosaccharide, APTS labelled; A2G(4)2S(6)2 glycan, APTS labelled
|
Biochemical Assay Reagents
|
Others
|
A2G2S2 glycan (G2S2), APTS labelled (A2G2S2 N-linked oligosaccharide, APTS labelled; A2G(4)2S(6)2 glycan, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-P3431A
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-158523
-
A2[3]G1 & A2[6]G1 N-linked oligosaccharide
|
Biochemical Assay Reagents
|
Others
|
A2[3]G1 & A2[6]G1 glycan (G1) (A2[3]G1 & A2[6]G1 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158479
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, APTS labelled
|
Biochemical Assay Reagents
|
Others
|
FA2[3]G1 & FA2[6]G1 glycan (G1F), APTS labelled (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158517
-
FA2G2S2 N-linked oligosaccharide, APTS labelled; F(6)A2G(4)2S(6)2 glycan, APTS labelled
|
Biochemical Assay Reagents
|
Others
|
FA2G2S2 glycan (G2FS2), APTS labelled (FA2G2S2 N-linked oligosaccharide, APTS labelled; F(6)A2G(4)2S(6)2 glycan, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158480
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, procainamide labelled
|
Biochemical Assay Reagents
|
Others
|
FA2[3]G1 & FA2[6]G1 glycan (G1F), procainamide labelled (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158515
-
FA2G2S2 N-linked oligosaccharide, 2-AB labelled; F(6)A2G(4)2S(6)2 glycan, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
FA2G2S2 glycan (G2FS2), 2-AB labelled (FA2G2S2 N-linked oligosaccharide, 2-AB labelled; F(6)A2G(4)2S(6)2 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158508
-
A2G2S2 N-linked oligosaccharide, 2-AA labelled; A2G(4)2S(6)2 glycan, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
A2G2S2 glycan (G2S2), 2-AA labelled (A2G2S2 N-linked oligosaccharide, 2-AA labelled; A2G(4)2S(6)2 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158481
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
FA2[3]G1 & FA2[6]G1 glycan (G1F), 2-AA labelled (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158520
-
A2[3]G1 & A2[6]G1 N-linked oligosaccharide, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
A2[3]G1 & A2[6]G1 glycan (G1), 2-AA labelled (A2[3]G1 & A2[6]G1 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158512
-
A2G2S2 N-linked oligosaccharide, 2-AB labelled; A2G(4)2S(6)2 glycan, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
A2G2S2 glycan (G2S2), 2-AB labelled (A2G2S2 N-linked oligosaccharide, 2-AB labelled; A2G(4)2S(6)2 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158478
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
FA2[3]G1 & FA2[6]G1 glycan (G1F), 2-AB labelled (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158518
-
FA2G2S2 N-linked oligosaccharide, 2-AA labelled; F(6)A2G(4)2S(6)2 glycan, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
FA2G2S2 glycan (G2FS2), 2-AA labelled (FA2G2S2 N-linked oligosaccharide, 2-AA labelled; F(6)A2G(4)2S(6)2 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-130495
-
CDDO-Trifluoethyl amide; RTA 404; TP-500
|
Keap1-Nrf2
Apoptosis
|
Cancer
|
CDDO-TFEA (RTA 404; TP-500) is a trifluoroacetamide derivative of CDDO with enhanced ability to cross the blood-brain barrier. CDDO is an Nrf2 activator that inhibits proliferation and induces differentiation and apoptosis in various cancer cells. CDDO-TFEA can enhance Nrf2 expression and signaling in various neurodegenerative disease models, including those mimicking multiple sclerosis, amyotrophic lateral sclerosis, and Huntington's disease. CDDO-TFEA induces apoptosis and blocks colony formation in Ewing's sarcoma and neuroblastoma cell lines with IC50 values ranging from 85-170 nM.
|
-
- HY-19487
-
|
Bacterial
|
Infection
|
Ribocil is a selective inhibitor targeting the bacterial FMN riboswitch, regulating the bacterial riboflavin riboswitch. Ribocil competitively binds to the FMN binding site, mimicking the natural ligand FMN to induce conformational changes in the riboswitch, inhibiting ribB gene expression, reducing riboflavin synthesis, and thus inhibiting bacterial growth. Ribocil strongly inhibits GFP expression (EC50=0.3 μM). Ribocil exhibits in vivo antibacterial activity in a mouse model and can be used to study antibacterial drugs related to drug-resistant bacterial infections and bacterial riboflavin metabolic pathways[1][2].
|
-
- HY-158456
-
FA2[3]BG1 & FA2[6]BG1 glycan N-linked oligosaccharide, 2-AB labelled; G1F with bisecting GlcNAc, 2-AB labelled
|
Biochemical Assay Reagents
|
Others
|
FA2[3]BG1 & FA2[6]BG1 glycan (G1B), 2-AB labelled (FA2[3]BG1 & FA2[6]BG1 glycan N-linked oligosaccharide, 2-AB labelled; G1F with bisecting GlcNAc, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158455
-
FA2[3]BG1 & FA2[6]BG1 glycan N-linked oligosaccharide, 2-AA labelled; G1F with bisecting GlcNAc, 2-AA labelled
|
Biochemical Assay Reagents
|
Others
|
FA2[3]BG1 & FA2[6]BG1 glycan (G1B), 2-AA labelled (FA2[3]BG1 & FA2[6]BG1 glycan N-linked oligosaccharide, 2-AA labelled; G1F with bisecting GlcNAc, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-P10302
-
|
GLP Receptor
Insulin Receptor
|
Metabolic Disease
|
GLP-1R/GIPR AgonIST-1 is a double-receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulin releasing peptide). GLP-1R/GIPR agonist-1 lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
|
-
- HY-158477
-
FA2G2S1 N-linked oligosaccharide; α(2,6)/FA2G2S(6)1 glycan; F(6)A2G(4)2S(6)1 glycan
|
Biochemical Assay Reagents
|
Others
|
FA2G2S1 glycan (G2FS1) (FA2G2S1 N-linked oligosaccharide; α(2,6)/FA2G2S(6)1 glycan; F(6)A2G(4)2S(6)1 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-131614
-
|
Calcium Channel
|
Others
|
TPC2-A1-N is a powerful and Ca 2+-permeable agonist of two pore channel 2 (TPC2), which plays its role by mimicking the physiological actions of NAADP. TPC2-A1-P reproducibly evokes significant Ca 2+ responses from TPC2 (EC50=7.8 μM), and the effect can be blocked by several TPC blockers. TPC2-A1-N can be used to probe different functions of TPC2 channels in intact cells .
|
-
- HY-158476
-
FA2G2S1 N-linked oligosaccharide, procainamide labelled; α(2,6)/FA2G2S(6)1 glycan, procainamide labelled; F(6)A2G(4)2S(6)1 glycan, procainamide labelled
|
Biochemical Assay Reagents
|
Others
|
FA2G2S1 glycan (G2FS1), procainamide labelled (FA2G2S1 N-linked oligosaccharide, procainamide labelled; α(2,6)/FA2G2S(6)1 glycan, procainamide labelled; F(6)A2G(4)2S(6)1 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-116748
-
|
PDI
Phosphatase
|
|
(±)-trans-1,2-Bis(2-mercaptoacetamido)cyclohexane is a small-molecule dithiol catalyst with a low thiol pKa value (8.3) and high reduction potential (-0.24 V), capable of mimicking PDI activity. It catalyzes the activation of scrambled ribonuclease A (scrambled ribonuclease A) and promotes the formation of native disulfide bonds, thereby significantly enhancing protein folding efficiency. Adding (±)-trans-1,2-Bis(2-mercaptoacetamido)cyclohexane to the culture medium of Saccharomyces cerevisiae can increase the secretion of exogenously expressed Schizosaccharomyces pombe acid phosphatase by more than threefold. (±)-trans-1,2-Bis(2-mercaptoacetamido)cyclohexane holds great potential for applications in protein production and secretion research .
|
-
- HY-131615
-
|
Sodium Channel
|
Others
|
TPC2-A1-P is a powerful and membrane permeable agonist of two pore channel 2 (TPC2) with an EC50 of 10.5 μM. TPC2-A1-P plays its role by mimicking the physiological actions of PI(3,5)P2. TPC2-A1-P also shows higher potency to induce Na 2+ mobilisation from TPC2 than TPC-A1-N (HY-131614). TPC2-A1-P can be used to probe different functions of TPC2 channels in intact cells .
|
-
- HY-B1306
-
p-Aminohippuric acid
|
Biochemical Assay Reagents
|
Neurological Disease
Metabolic Disease
|
4-Aminohippuric acid (p-Aminohippuric acid) is a coordination ligand for metal ions (such as Cu 2+, Fe 3+, Hg 2+) and a functionalization reagent for nanomaterials. 4-Aminohippuric acid can coordinate with metal ions or modify the surface of materials such as carbon nanotubes and gold nanoparticles through amino and carboxyl groups. 4-Aminohippuric acid can form stable complexes with metal ions or participate in the synthesis of nanomaterials as a reducing agent/stabilizer, enriching metal ions or giving nanoparticles peroxidase-mimicking activity. 4-Aminohippuric acid can be used to construct highly sensitive electrochemical sensors or colorimetric sensors to detect and quantitatively analyze heavy metal ions such as copper, iron, and mercury in environmental water samples and biological samples. 4-Aminohippuric acid may also be a biomarker for attention-deficit/hyperactivity disorder (ADHD) .
|
-
- HY-N3021
-
|
Endogenous Metabolite
NF-κB
TNF Receptor
FOXO
Microtubule/Tubulin
|
Metabolic Disease
|
D-chiro-Inositol is a stereoisomer of inositol that exhibits activities such as improving glucose metabolism, anti-tumor effects, anti-inflammatory properties, and antioxidant activity. D-chiro-Inositol effectively alleviates cholestasis by enhancing bile acid secretion and reducing oxidative stress. D-chiro-Inositol improves insulin resistance, lowers hyperglycemia and circulating insulin levels, reduces serum androgen levels, and ameliorates some metabolic abnormalities associated with X syndrome by mimicking the action of insulin. Additionally, D-chiro-Inositol can induce a reduction in pro-inflammatory factors (such as Nf-κB) and cytokines (such as TNF-α), thereby exerting anti-inflammatory effects. D-chiro-Inositol may be used in the study of liver cirrhosis, breast cancer, type 2 diabetes, and polycystic ovary syndrome .
|
-
- HY-P10302A
-
|
GLP Receptor
|
Metabolic Disease
|
GLP-1R/GIPR agonist-1 soduim is the sodium salt form of GLP-1R/GIPR agonist-1 (HY-P10302). GLP-1R/GIPR agonist-1 soduim is a dual agonist for glucagon-like peptide-1 receptor (GLP-1R, EC50 is 0.57 nM) and glucose-dependent insulin releasing peptide receptor (GIPR, EC50 is 0.75 nM). GLP-1R/GIPR agonist-1 soduim lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 soduim can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
|
-
- HY-B1306R
-
p-Aminohippuric acid (Standard)
|
Biochemical Assay Reagents
|
Neurological Disease
Metabolic Disease
|
4-Aminohippuric acid (p-Aminohippuric acid) (Standard) is the analytical standard of 4-Aminohippuric acid (HY-B1306). This product is intended for research and analytical applications. 4-Aminohippuric acid (p-Aminohippuric acid) is a coordination ligand for metal ions (such as Cu 2+, Fe 3+, Hg 2+) and a functionalization reagent for nanomaterials. 4-Aminohippuric acid can coordinate with metal ions or modify the surface of materials such as carbon nanotubes and gold nanoparticles through amino and carboxyl groups. 4-Aminohippuric acid can form stable complexes with metal ions or participate in the synthesis of nanomaterials as a reducing agent/stabilizer, enriching metal ions or giving nanoparticles peroxidase-mimicking activity. 4-Aminohippuric acid can be used to construct highly sensitive electrochemical sensors or colorimetric sensors to detect and quantitatively analyze heavy metal ions such as copper, iron, and mercury in environmental water samples and biological samples. 4-Aminohippuric acid may also be a biomarker for attention-deficit/hyperactivity disorder (ADHD) .
|
-
- HY-B1306S
-
p-Aminohippuric acid-d4
|
Biochemical Assay Reagents
|
Neurological Disease
Metabolic Disease
|
4-Aminohippuric acid-d4 (p-Aminohippuric acid-d4) is the deuterium labeled 4-Aminohippuric acid (HY-B1306). 4-Aminohippuric acid (p-Aminohippuric acid) is a coordination ligand for metal ions (such as Cu 2+, Fe 3+, Hg 2+) and a functionalization reagent for nanomaterials. 4-Aminohippuric acid can coordinate with metal ions or modify the surface of materials such as carbon nanotubes and gold nanoparticles through amino and carboxyl groups. 4-Aminohippuric acid can form stable complexes with metal ions or participate in the synthesis of nanomaterials as a reducing agent/stabilizer, enriching metal ions or giving nanoparticles peroxidase-mimicking activity. 4-Aminohippuric acid can be used to construct highly sensitive electrochemical sensors or colorimetric sensors to detect and quantitatively analyze heavy metal ions such as copper, iron, and mercury in environmental water samples and biological samples. 4-Aminohippuric acid may also be a biomarker for attention-deficit/hyperactivity disorder (ADHD) .
|
-
- HY-112624K
-
Dextran 5; Dextran D5; Dextran T5(MW 4500-5500)
|
Apoptosis
Autophagy
|
Others
|
Dextran T5 (MW 5,000) is a sulfated polysaccharide anti-apoptotic and autophagic agent. Dextran T5 (MW 5,000) has sulfated groups and interacts with cell membranes by mimicking endogenous glycosaminoglycans, inhibiting the mitochondrial apoptotic pathway and delaying DNA fragmentation to exert anti-apoptotic activity. Dextran T5 (MW 5,000) also promotes the conversion of LC3-I to LC3-II and the formation of autophagosomes to activate the autophagic pathway. Dextran T5 (MW 5,000) can prolong the survival cycle of CHO cells and increase the production of recombinant erythropoietin (EPO). The Dextran series of compounds are also natural polysaccharide drug carriers that can be connected to drugs through covalent bonding methods such as ester bonds, amide bonds or click chemistry, or self-assembled to form carriers such as nanoparticles and hydrogels. Dextran is biodegradable and biocompatible, and can achieve targeted delivery and controlled release of drugs. Dextran derivatives can prolong drug half-life, increase local concentration and reduce immune clearance activity. The Dextran series of compounds are also natural polysaccharide drug carriers that can be connected to drugs through covalent bonding methods such as ester bonds, amide bonds or click chemistry, or self-assembled to form carriers such as nanoparticles and hydrogels. Dextran is biodegradable and biocompatible, and can achieve targeted delivery and controlled release of drugs. Dextran derivatives can prolong the half-life of drugs, increase local concentrations, and reduce the activity of immune clearance .
|
-
Cat. No. |
Product Name |
Type |
-
- HY-D2361
-
|
Dyes
|
Adenosine 2'-PEG-Biotin is a biochemical reagent derived from adenosine. Adenosine 2'-PEG-Biotin regulates cell signaling pathways by mimicking the effects of endogenous adenosine and binding to its receptors. Adenosine 2'-PEG-Biotin can be used in the research of bioprobes, biosensors and diagnostic reagents .
|
Cat. No. |
Product Name |
Type |
-
- HY-W142596
-
|
Drug Delivery
|
1,2-DImyristoyl-rac-glycero-3-phosphocholine (DMPC), a zwitterionic phospholipid, is chosen as a simple eukaryotic cell membrane, mimicking the neutral charge of the surface membrane of eukaryotic plasma membranes .
|
-
- HY-167815
-
|
Cell Assay Reagents
|
Myo-Inositol hexasulfate hexapotassium is a sulfated derivative of inositol that has the activity of mimicking highly sulfated polysaccharides such as heparin, affecting many cell signaling pathways.
|
-
- HY-158464
-
|
Carbohydrates
|
Fetuin glycoprotein is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158466
-
|
Carbohydrates
|
Human IgG Glycoprotein is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158528
-
A3 N-linked oligosaccharide
|
Carbohydrates
|
A3 glycan (A3 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158532
-
A4 N-linked oligosaccharide
|
Carbohydrates
|
A4 glycan (A4 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158494
-
A2 N-linked oligosaccharide
|
Carbohydrates
|
A2 glycan (G0) (A2 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158460
-
Galactose-alpha-1,3-galactose
|
Carbohydrates
|
Alpha-Gal (Galactose-alpha-1,3-galactose) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158490
-
A4G4 N-linked oligosaccharide
|
Carbohydrates
|
A4G4 glycan (A4G4 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158542
-
A4 N-linked oligosaccharide, procainamide labelled
|
Carbohydrates
|
A4 glycan, procainamide labelled (A4 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158531
-
A3 N-linked oligosaccharide, procainamide labelled
|
Carbohydrates
|
A3 glycan, procainamide labelled (A3 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158472
-
|
Carbohydrates
|
Sialylated Core 1 O-glycan (C1S(3)1) () is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158534
-
Mannose-8 N-linked oligosaccharide; Oligomannose 8 glycan
|
Carbohydrates
|
M8 glycan (Man8) (Mannose-8 N-linked oligosaccharide; Oligomannose 8 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158493
-
A2 N-linked oligosaccharide, procainamide labelled
|
Carbohydrates
|
A2 glycan (G0), procainamide labelled (A2 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158463
-
|
Carbohydrates
|
A2G2S2-KVANKT glycopeptide is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158509
-
Mannose-6 N-linked oligosaccharide; Oligomannose 6 glycan
|
Carbohydrates
|
M6 glycan (Man6) (Mannose-6 N-linked oligosaccharide; Oligomannose 6 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158497
-
A2 N-linked oligosaccharide, APTS labelled
|
Carbohydrates
|
A2 glycan (G0), APTS labelled (A2 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158485
-
Mannose-5 N-linked oligosaccharide; Oligomannose 5 glycan
|
Carbohydrates
|
M5 glycan (Man5) (Mannose-5 N-linked oligosaccharide; Oligomannose 5 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158519
-
Mannose-7 N-linked oligosaccharide; Oligomannose 7 glycan
|
Carbohydrates
|
M7 glycan (Man7) (Mannose-7 N-linked oligosaccharide; Oligomannose 7 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158543
-
Mannose-9 N-linked oligosaccharide; Oligomannose 9 glycan
|
Carbohydrates
|
M9 glycan (Man9) (Mannose-9 N-linked oligosaccharide; Oligomannose 9 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158482
-
Mannose-3 N-linked oligosaccharide; Oligomannose 3 glycan
|
Carbohydrates
|
M3 glycan (Man3) (Mannose-3 N-linked oligosaccharide; Oligomannose 3 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158516
-
Mannose-6 N-linked oligosaccharide, procainamide labelled; Oligomannose 6 glycan, procainamide labelled
|
Carbohydrates
|
M6 glycan (Man6), procainamide labelled (Mannose-6 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158541
-
A4 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A4 glycan, 2-AB labelled (A4 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158540
-
A4 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A4 glycan, 2-AA labelled (A4 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158468
-
|
Carbohydrates
|
Sialylated Core 1 O-glycan (C1S(3)1), 2AB labelled () is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158529
-
A3 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A3 glycan, 2-AA labelled (A3 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158530
-
A3 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A3 glycan, 2-AB labelled (A3 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158498
-
FA2 N-linked oligosaccharide; F(6)A2 glycan
|
Carbohydrates
|
FA2 glycan (G0F) (FA2 N-linked oligosaccharide; F(6)A2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158496
-
A2 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A2 glycan (G0), 2-AB labelled (A2 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158446
-
A2G2 N-linked oligosaccharide, APTS labelled
|
Carbohydrates
|
A2G2 glycan (G2), APTS labelled (A2G2 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158461
-
Galactose-alpha-1,3-galactose, 2-AA labelled
|
Carbohydrates
|
Alpha-Gal standard, 2-AA labelled (Galactose-alpha-1,3-galactose, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158462
-
Galactose-alpha-1,3-galactose, 2-AB labelled
|
Carbohydrates
|
Alpha-Gal standard, 2-AB labelled (Galactose-alpha-1,3-galactose, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158537
-
A3G3S3 N-linked oligosaccharide, procainamide labelled
|
Carbohydrates
|
A3G3S3 glycan, procainamide labelled (A3G3S3 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158491
-
A4G4 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A4G4 glycan, 2-AA labelled (A4G4 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158492
-
A4G4 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A4G4 glycan, 2-AB labelled (A4G4 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158539
-
Mannose-8 N-linked oligosaccharide, procainamide labelled; Oligomannose 8 glycan, procainamide labelled
|
Carbohydrates
|
M8 glycan (Man8), procainamide labelled (Mannose-8 N-linked oligosaccharide, procainamide labelled; Oligomannose 8 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158546
-
Mannose-9 N-linked oligosaccharide, procainamide labelled; Oligomannose 9 glycan, procainamide labelled
|
Carbohydrates
|
M9 glycan (Man9), procainamide labelled (Mannose-9 N-linked oligosaccharide, procainamide labelled; Oligomannose 9 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158505
-
Mannose-5 N-linked oligosaccharide, APTS labelled; Oligomannose 5 glycan, APTS labelled
|
Carbohydrates
|
M5 glycan (Man5), APTS labelled (Mannose-5 N-linked oligosaccharide, APTS labelled; Oligomannose 5 glycan, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158526
-
Mannose-7 N-linked oligosaccharide, procainamide labelled; Oligomannose 7 glycan, procainamide labelled
|
Carbohydrates
|
M7 glycan (Man7), procainamide labelled (Mannose-7 N-linked oligosaccharide, procainamide labelled; Oligomannose 7 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158507
-
Mannose-5 N-linked oligosaccharide, procainamide labelled; Oligomannose 5 glycan, procainamide labelled
|
Carbohydrates
|
M5 glycan (Man5), procainamide labelled (Mannose-5 N-linked oligosaccharide, procainamide labelled; Oligomannose 5 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158452
-
A3G3 N-linked oligosaccharide; A3G(4)3 glycan
|
Carbohydrates
|
A3G3 glycan (G3) (A3G3 N-linked oligosaccharide; A3G(4)3 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158444
-
A2G2 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A2G2 glycan (G2), 2-AA labelled (A2G2 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158465
-
F(3)A2 glycan-KVANKT & F(6)A2 glycan-KVANKT
|
Carbohydrates
|
GPEP FA2-KVANKT glycopeptide (F(3)A2 glycan-KVANKT & F(6)A2 glycan-KVANKT) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158488
-
A3G3 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A3G3 glycan (G3), 2-AB labelled (A3G3 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158442
-
A2G2 N-linked oligosaccharide; A2G(4)2 glycan
|
Carbohydrates
|
A2G2 glycan (G2) (A2G2 N-linked oligosaccharide; A2G(4)2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158487
-
A3G3 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A3G3 glycan (G3), 2-AA labelled (A3G3 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158445
-
A2G2 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A2G2 glycan (G2), 2-AB labelled (A2G2 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158474
-
A2G2S1 N-linked oligosaccharide, APTS labelled
|
Carbohydrates
|
A2G2S1 glycan (G2S1), APTS labelled (A2G2S1 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158527
-
FA2 N-linked oligosaccharide, APTS labelled; F(6)A2 glycan, APTS labelled
|
Carbohydrates
|
FA2 glycan (G0F), APTS labelled (FA2 N-linked oligosaccharide, APTS labelled; F(6)A2 glycan, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
-
- HY-158448
-
FA2G2 N-linked oligosaccharide; F(6)A2G2
|
Carbohydrates
|
FA2G2 glycan (G2F) (FA2G2 N-linked oligosaccharide; F(6)A2G2) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158504
-
FA2G2S1 N-linked oligosaccharide, APTS labelled
|
Carbohydrates
|
FA2G2S1 glycan (G2FS1), APTS labelled (FA2G2S1 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158533
-
A3G3S3 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A3G3S3 glycan, 2-AA labelled (A3G3S3 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158535
-
A3G3S3 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A3G3S3 glycan, 2-AB labelled (A3G3S3 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158514
-
Mannose-6 N-linked oligosaccharide, 2-AB labelled; Oligomannose 6 glycan, 2-AB labelled
|
Carbohydrates
|
M6 glycan (Man6), 2-AB labelled (Mannose-6 N-linked oligosaccharide, 2-AB labelled; Oligomannose 6 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158483
-
Mannose-3 N-linked oligosaccharide, 2-AA labelled; Oligomannose 3 glycan, 2-AA labelled
|
Carbohydrates
|
M3 glycan (Man3), 2-AA labelled (Mannose-3 N-linked oligosaccharide, 2-AA labelled; Oligomannose 3 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158511
-
Mannose-6 N-linked oligosaccharide, 2-AA labelled; Oligomannose 6 glycan, 2-AA labelled
|
Carbohydrates
|
M6 glycan (Man6), 2-AA labelled (Mannose-6 N-linked oligosaccharide, 2-AA labelled; Oligomannose 6 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158503
-
Mannose-5 N-linked oligosaccharide, 2-AB labelled; Oligomannose 5 glycan, 2-AB labelled
|
Carbohydrates
|
M5 glycan (Man5), 2-AB labelled (Mannose-5 N-linked oligosaccharide, 2-AB labelled; Oligomannose 5 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158521
-
Mannose-7 N-linked oligosaccharide, 2-AA labelled; Oligomannose 7 glycan, 2-AA labelled
|
Carbohydrates
|
M7 glycan (Man7), 2-AA labelled (Mannose-7 N-linked oligosaccharide, 2-AA labelled; Oligomannose 7 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158524
-
Mannose-7 N-linked oligosaccharide, 2-AB labelled; Oligomannose 7 glycan, 2-AB labelled
|
Carbohydrates
|
M7 glycan (Man7), 2-AB labelled (Mannose-7 N-linked oligosaccharide, 2-AB labelled; Oligomannose 7 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158545
-
Mannose-9 N-linked oligosaccharide, 2-AB labelled; Oligomannose 9 glycan, 2-AB labelled
|
Carbohydrates
|
M9 glycan (Man9), 2-AB labelled (Mannose-9 N-linked oligosaccharide, 2-AB labelled; Oligomannose 9 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158544
-
Mannose-9 N-linked oligosaccharide, 2-AA labelled; Oligomannose 9 glycan, 2-AA labelled
|
Carbohydrates
|
M9 glycan (Man9), 2-AA labelled (Mannose-9 N-linked oligosaccharide, 2-AA labelled; Oligomannose 9 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158536
-
Mannose-8 N-linked oligosaccharide, 2-AA labelled; Oligomannose 8 glycan, 2-AA labelled
|
Carbohydrates
|
M8 glycan (Man8), 2-AA labelled (Mannose-8 N-linked oligosaccharide, 2-AA labelled; Oligomannose 8 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158484
-
Mannose-3 N-linked oligosaccharide, 2-AB labelled; Oligomannose 3 glycan, 2-AB labelled
|
Carbohydrates
|
M3 glycan (Man3), 2-AB labelled (Mannose-3 N-linked oligosaccharide, 2-AB labelled; Oligomannose 3 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158501
-
Mannose-5 N-linked oligosaccharide, 2-AA labelled; Oligomannose 5 glycan, 2-AA labelled
|
Carbohydrates
|
M5 glycan (Man5), 2-AA labelled (Mannose-5 N-linked oligosaccharide, 2-AA labelled; Oligomannose 5 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158538
-
Mannose-8 N-linked oligosaccharide, 2-AB labelled; Oligomannose 8 glycan, 2-AB labelled
|
Carbohydrates
|
M8 glycan (Man8), 2-AB labelled (Mannose-8 N-linked oligosaccharide, 2-AB labelled; Oligomannose 8 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158443
-
A2G2S1 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
A2G2S1 glycan (G2S1), 2-AB labelled (A2G2S1 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158502
-
FA2G2S1 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
FA2G2S1 glycan (G2FS1), 2-AB labelled (FA2G2S1 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158441
-
A2G2S1 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A2G2S1 glycan (G2S1), 2-AA labelled (A2G2S1 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158447
-
A2G2 N-linked oligosaccharide, procainamide labelled; A2G(4)2 glycan, procainamide labelled
|
Carbohydrates
|
A2G2 glycan (G2), procainamide labelled (A2G2 N-linked oligosaccharide, procainamide labelled; A2G(4)2 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158486
-
FA2G2S1 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
FA2G2S1 glycan (G2FS1), 2-AA labelled (FA2G2S1 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158489
-
A3G3 N-linked oligosaccharide, procainamide labelled; A3G(4)3 glycan, procainamide labelled
|
Carbohydrates
|
A3G3 glycan (G3), procainamide labelled (A3G3 N-linked oligosaccharide, procainamide labelled; A3G(4)3 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158499
-
FA2 N-linked oligosaccharide, 2-AA labelled; F(6)A2 glycan, 2-AA labelled
|
Carbohydrates
|
FA2 glycan (G0F), 2-AA labelled (FA2 N-linked oligosaccharide, 2-AA labelled; F(6)A2 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158500
-
FA2 N-linked oligosaccharide, 2-AB labelled; F(6)A2 glycan, 2-AB labelled
|
Carbohydrates
|
FA2 glycan (G0F), 2-AB labelled (FA2 N-linked oligosaccharide, 2-AB labelled; F(6)A2 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158453
-
FA2B N-linked oligosaccharide, 2-AA labelled; G0F with bisecting GlcNAc, 2-AA labelled
|
Carbohydrates
|
FA2B glycan (G0B), 2-AA labelled (FA2B N-linked oligosaccharide, 2-AA labelled; G0F with bisecting GlcNAc, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158454
-
FA2B N-linked oligosaccharide, 2-AB labelled; G0F with bisecting GlcNAc, 2-AB labelled
|
Carbohydrates
|
FA2B glycan (G0B), 2-AB labelled (FA2B N-linked oligosaccharide, 2-AB labelled; G0F with bisecting GlcNAc, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158451
-
FA2G2 N-linked oligosaccharide, APTS labelled; F(6)A2G2, APTS labelled
|
Carbohydrates
|
FA2G2 glycan (G2F), APTS labelled (FA2G2 N-linked oligosaccharide, APTS labelled; F(6)A2G2, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158475
-
A2G2S1 N-linked oligosaccharide; A2G(4)2S(6)1 glycan
|
Carbohydrates
|
A2G2S1 glycan (G2S1) (A2G2S1 N-linked oligosaccharide; A2G(4)2S(6)1 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158506
-
A2G2S2 N-linked oligosaccharide; A2G(4)2S(6)2 glycan
|
Carbohydrates
|
A2G2S2 glycan (G2S2) (A2G2S2 N-linked oligosaccharide; A2G(4)2S(6)2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158513
-
FA2G2S2 N-linked oligosaccharide; F(6)A2G(4)2S(6)2 glycan
|
Carbohydrates
|
FA2G2S2 glycan (G2FS2) (FA2G2S2 N-linked oligosaccharide; F(6)A2G(4)2S(6)2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158449
-
FA2G2 N-linked oligosaccharide, 2-AA labelled; F(6)A2G2, 2-AA labelled
|
Carbohydrates
|
FA2G2 glycan (G2F), 2-AA labelled (FA2G2 N-linked oligosaccharide, 2-AA labelled; F(6)A2G2, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158450
-
FA2G2 N-linked oligosaccharide, 2-AB labelled; F(6)A2G2, 2-AB labelled
|
Carbohydrates
|
FA2G2 glycan (G2F), 2-AB labelled (FA2G2 N-linked oligosaccharide, 2-AB labelled; F(6)A2G2, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158473
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide
|
Carbohydrates
|
FA2[3]G1 & FA2[6]G1 glycan (G1F) (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158510
-
A2G2S2 N-linked oligosaccharide, APTS labelled; A2G(4)2S(6)2 glycan, APTS labelled
|
Carbohydrates
|
A2G2S2 glycan (G2S2), APTS labelled (A2G2S2 N-linked oligosaccharide, APTS labelled; A2G(4)2S(6)2 glycan, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158523
-
A2[3]G1 & A2[6]G1 N-linked oligosaccharide
|
Carbohydrates
|
A2[3]G1 & A2[6]G1 glycan (G1) (A2[3]G1 & A2[6]G1 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158479
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, APTS labelled
|
Carbohydrates
|
FA2[3]G1 & FA2[6]G1 glycan (G1F), APTS labelled (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158517
-
FA2G2S2 N-linked oligosaccharide, APTS labelled; F(6)A2G(4)2S(6)2 glycan, APTS labelled
|
Carbohydrates
|
FA2G2S2 glycan (G2FS2), APTS labelled (FA2G2S2 N-linked oligosaccharide, APTS labelled; F(6)A2G(4)2S(6)2 glycan, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158480
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, procainamide labelled
|
Carbohydrates
|
FA2[3]G1 & FA2[6]G1 glycan (G1F), procainamide labelled (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158515
-
FA2G2S2 N-linked oligosaccharide, 2-AB labelled; F(6)A2G(4)2S(6)2 glycan, 2-AB labelled
|
Carbohydrates
|
FA2G2S2 glycan (G2FS2), 2-AB labelled (FA2G2S2 N-linked oligosaccharide, 2-AB labelled; F(6)A2G(4)2S(6)2 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158508
-
A2G2S2 N-linked oligosaccharide, 2-AA labelled; A2G(4)2S(6)2 glycan, 2-AA labelled
|
Carbohydrates
|
A2G2S2 glycan (G2S2), 2-AA labelled (A2G2S2 N-linked oligosaccharide, 2-AA labelled; A2G(4)2S(6)2 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158481
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
FA2[3]G1 & FA2[6]G1 glycan (G1F), 2-AA labelled (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158520
-
A2[3]G1 & A2[6]G1 N-linked oligosaccharide, 2-AA labelled
|
Carbohydrates
|
A2[3]G1 & A2[6]G1 glycan (G1), 2-AA labelled (A2[3]G1 & A2[6]G1 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158512
-
A2G2S2 N-linked oligosaccharide, 2-AB labelled; A2G(4)2S(6)2 glycan, 2-AB labelled
|
Carbohydrates
|
A2G2S2 glycan (G2S2), 2-AB labelled (A2G2S2 N-linked oligosaccharide, 2-AB labelled; A2G(4)2S(6)2 glycan, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158478
-
FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, 2-AB labelled
|
Carbohydrates
|
FA2[3]G1 & FA2[6]G1 glycan (G1F), 2-AB labelled (FA2[3]G1 & FA2[6]G1 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158518
-
FA2G2S2 N-linked oligosaccharide, 2-AA labelled; F(6)A2G(4)2S(6)2 glycan, 2-AA labelled
|
Carbohydrates
|
FA2G2S2 glycan (G2FS2), 2-AA labelled (FA2G2S2 N-linked oligosaccharide, 2-AA labelled; F(6)A2G(4)2S(6)2 glycan, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158456
-
FA2[3]BG1 & FA2[6]BG1 glycan N-linked oligosaccharide, 2-AB labelled; G1F with bisecting GlcNAc, 2-AB labelled
|
Carbohydrates
|
FA2[3]BG1 & FA2[6]BG1 glycan (G1B), 2-AB labelled (FA2[3]BG1 & FA2[6]BG1 glycan N-linked oligosaccharide, 2-AB labelled; G1F with bisecting GlcNAc, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158455
-
FA2[3]BG1 & FA2[6]BG1 glycan N-linked oligosaccharide, 2-AA labelled; G1F with bisecting GlcNAc, 2-AA labelled
|
Carbohydrates
|
FA2[3]BG1 & FA2[6]BG1 glycan (G1B), 2-AA labelled (FA2[3]BG1 & FA2[6]BG1 glycan N-linked oligosaccharide, 2-AA labelled; G1F with bisecting GlcNAc, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158477
-
FA2G2S1 N-linked oligosaccharide; α(2,6)/FA2G2S(6)1 glycan; F(6)A2G(4)2S(6)1 glycan
|
Carbohydrates
|
FA2G2S1 glycan (G2FS1) (FA2G2S1 N-linked oligosaccharide; α(2,6)/FA2G2S(6)1 glycan; F(6)A2G(4)2S(6)1 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-158476
-
FA2G2S1 N-linked oligosaccharide, procainamide labelled; α(2,6)/FA2G2S(6)1 glycan, procainamide labelled; F(6)A2G(4)2S(6)1 glycan, procainamide labelled
|
Carbohydrates
|
FA2G2S1 glycan (G2FS1), procainamide labelled (FA2G2S1 N-linked oligosaccharide, procainamide labelled; α(2,6)/FA2G2S(6)1 glycan, procainamide labelled; F(6)A2G(4)2S(6)1 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .
|
- HY-112624K
-
Dextran 5; Dextran D5; Dextran T5(MW 4500-5500)
|
Thickeners
|
Dextran T5 (MW 5,000) is a sulfated polysaccharide anti-apoptotic and autophagic agent. Dextran T5 (MW 5,000) has sulfated groups and interacts with cell membranes by mimicking endogenous glycosaminoglycans, inhibiting the mitochondrial apoptotic pathway and delaying DNA fragmentation to exert anti-apoptotic activity. Dextran T5 (MW 5,000) also promotes the conversion of LC3-I to LC3-II and the formation of autophagosomes to activate the autophagic pathway. Dextran T5 (MW 5,000) can prolong the survival cycle of CHO cells and increase the production of recombinant erythropoietin (EPO). The Dextran series of compounds are also natural polysaccharide drug carriers that can be connected to drugs through covalent bonding methods such as ester bonds, amide bonds or click chemistry, or self-assembled to form carriers such as nanoparticles and hydrogels. Dextran is biodegradable and biocompatible, and can achieve targeted delivery and controlled release of drugs. Dextran derivatives can prolong drug half-life, increase local concentration and reduce immune clearance activity. The Dextran series of compounds are also natural polysaccharide drug carriers that can be connected to drugs through covalent bonding methods such as ester bonds, amide bonds or click chemistry, or self-assembled to form carriers such as nanoparticles and hydrogels. Dextran is biodegradable and biocompatible, and can achieve targeted delivery and controlled release of drugs. Dextran derivatives can prolong the half-life of drugs, increase local concentrations, and reduce the activity of immune clearance .
|
Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P5558
-
|
VEGFR
|
Inflammation/Immunology
|
KLTWQELYQLKYKGI (QK) is a VEGF mimicking peptide, binds to the VEGF receptors and competes with VEGF. KLTWQELYQLKYKGI is active in gastric ulcer healing in rodents when administered either orally or systemically. KLTWQELYQLKYKGI shows the ability to induce capillary formation and organization in vitro .
|
-
- HY-P1416
-
Foxy-5
Maximum Cited Publications
6 Publications Verification
|
Wnt
|
Cancer
|
Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .
|
-
- HY-P1416A
-
Foxy-5 TFA
Maximum Cited Publications
6 Publications Verification
|
Wnt
|
Cancer
|
Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .
|
-
- HY-P0102
-
|
mAChR
|
Neurological Disease
|
Dipeptide diaminobutyroyl benzylamide diacetate, a Wagerlin-1-mimicking peptide, is a mAChR antagonist. Dipeptide diaminobutyroyl benzylamide diacetate can induce muscle relaxation .
|
-
- HY-P10026
-
LY-3457263
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
Nisotirotide (LY-3457263) is a subcutaneous injectable NPY2 receptor agonist. By mimicking peptide YY (PYY), Nisotirotide inhibits appetite and can be used in the research of diseases such as obesity and diabetes .
|
-
- HY-P10512
-
|
Peptides
|
Others
|
BDC2.5 mimotope is a potent antigen-mimicking peptide that can activate CD4+ T cell populations that have the same antigen recognition properties as BDC2.5 cells. BDC2.5 mimotope can be used to study the prevention or treatment of type 1 diabetes by targeting specific T cell populations .
|
-
- HY-P10428
-
|
HPV
|
Infection
|
E6AP-mimicking peptide (compound 13) is a high-affinity, selective, irreversible and potent peptide-based covalent HPV16 E6 inhibitor targeting the 16E6 oncoprotein using a cysteine-reactive acrylamide warhead. E6AP-mimicking peptide has a Ki of 17 nM. E6AP-mimicking peptide targets all residues appearing in the binding pocket of E6 to disrupt the binding interface of 16E6 and E6AP. E6AP-mimicking peptide selectively binds and crosslinks to MBP-16E6 in PBS or a protein mixture .
|
-
- HY-P5171
-
|
Wnt
|
Cancer
|
MDGCEL is a WNT5A peptide, that acts as a WNT5A mimicks and exhibits WNT5A antagonistic activity .
|
-
- HY-P10626
-
NSPr
|
Peptides
|
Others
|
Nanodisc scaffold peptide (NSPr) is an amphipathic double-helical peptide that stabilizes membrane proteins by mimicking their natural environment, allowing them to remain stable and active in detergent-free aqueous solutions. Nanodisc scaffold peptide can be used to construct a universal tool for high-throughput stabilization of membrane proteins, facilitating modern biological research .
|
-
- HY-P5371
-
|
Thrombin
|
Others
|
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)
|
-
- HY-P10356
-
|
TRP Channel
|
Others
|
T100-Mut is a cell-permeable peptide whose N-terminus is conjugated with a myristoylated group to enable T100-Mut to penetrate and localize to the inner side of the plasma membrane, thus mimicking the topology of Tmem100-3Q. T100-Mut can alleviate TRPA1-mediated pain .
|
-
- HY-N2466A
-
MT-I acetate; [Nle4,D-Phe7]-α-MSH acetate
|
Melanocortin Receptor
|
Cancer
|
Melanotan I acetate is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I acetate is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I acetate can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I acetate can be used for sunlight-induced skin cancers research .
|
-
- HY-P3431
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-N2466
-
MT-I; [Nle4,D-Phe7]-α-MSH
|
Melanocortin Receptor
|
Neurological Disease
Cancer
|
Melanotan I is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I can be used for the research of sun-induced skin cancer, melanoma, inflammation and male erectile dysfunction .
|
-
- HY-P3431A
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P10302
-
|
GLP Receptor
Insulin Receptor
|
Metabolic Disease
|
GLP-1R/GIPR AgonIST-1 is a double-receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulin releasing peptide). GLP-1R/GIPR agonist-1 lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
|
-
- HY-P10302A
-
|
GLP Receptor
|
Metabolic Disease
|
GLP-1R/GIPR agonist-1 soduim is the sodium salt form of GLP-1R/GIPR agonist-1 (HY-P10302). GLP-1R/GIPR agonist-1 soduim is a dual agonist for glucagon-like peptide-1 receptor (GLP-1R, EC50 is 0.57 nM) and glucose-dependent insulin releasing peptide receptor (GIPR, EC50 is 0.75 nM). GLP-1R/GIPR agonist-1 soduim lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 soduim can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
|
Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P991337
-
-
- HY-P991069
-
|
HIV
|
Infection
|
VRC-01 is a fully human IgG1 antibody that targets envelope glycoprotein gp120 Protein. VRC-01 blocks viral entry by partially mimicking the interaction of the CD4 receptor with HIV-1 gp120 envelope glycoprotein. The isotype control for VRC-01 can refer to Human IgG1 kappa, Isotype Control (HY-P99001) .
|
Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
-
- HY-17551
-
-
-
- HY-N11420
-
-
-
- HY-B1306
-
p-Aminohippuric acid
|
Structural Classification
Classification of Application Fields
Ketones, Aldehydes, Acids
Source classification
Other Diseases
Endogenous metabolite
Disease Research Fields
|
Biochemical Assay Reagents
|
4-Aminohippuric acid (p-Aminohippuric acid) is a coordination ligand for metal ions (such as Cu 2+, Fe 3+, Hg 2+) and a functionalization reagent for nanomaterials. 4-Aminohippuric acid can coordinate with metal ions or modify the surface of materials such as carbon nanotubes and gold nanoparticles through amino and carboxyl groups. 4-Aminohippuric acid can form stable complexes with metal ions or participate in the synthesis of nanomaterials as a reducing agent/stabilizer, enriching metal ions or giving nanoparticles peroxidase-mimicking activity. 4-Aminohippuric acid can be used to construct highly sensitive electrochemical sensors or colorimetric sensors to detect and quantitatively analyze heavy metal ions such as copper, iron, and mercury in environmental water samples and biological samples. 4-Aminohippuric acid may also be a biomarker for attention-deficit/hyperactivity disorder (ADHD) .
|
-
-
- HY-N3021
-
|
Structural Classification
Natural Products
Classification of Application Fields
Source classification
Metabolic Disease
Endogenous metabolite
Disease Research Fields
|
Endogenous Metabolite
NF-κB
TNF Receptor
FOXO
Microtubule/Tubulin
|
D-chiro-Inositol is a stereoisomer of inositol that exhibits activities such as improving glucose metabolism, anti-tumor effects, anti-inflammatory properties, and antioxidant activity. D-chiro-Inositol effectively alleviates cholestasis by enhancing bile acid secretion and reducing oxidative stress. D-chiro-Inositol improves insulin resistance, lowers hyperglycemia and circulating insulin levels, reduces serum androgen levels, and ameliorates some metabolic abnormalities associated with X syndrome by mimicking the action of insulin. Additionally, D-chiro-Inositol can induce a reduction in pro-inflammatory factors (such as Nf-κB) and cytokines (such as TNF-α), thereby exerting anti-inflammatory effects. D-chiro-Inositol may be used in the study of liver cirrhosis, breast cancer, type 2 diabetes, and polycystic ovary syndrome .
|
-
-
- HY-B1306R
-
p-Aminohippuric acid (Standard)
|
Structural Classification
Ketones, Aldehydes, Acids
Source classification
Endogenous metabolite
|
Biochemical Assay Reagents
|
4-Aminohippuric acid (p-Aminohippuric acid) (Standard) is the analytical standard of 4-Aminohippuric acid (HY-B1306). This product is intended for research and analytical applications. 4-Aminohippuric acid (p-Aminohippuric acid) is a coordination ligand for metal ions (such as Cu 2+, Fe 3+, Hg 2+) and a functionalization reagent for nanomaterials. 4-Aminohippuric acid can coordinate with metal ions or modify the surface of materials such as carbon nanotubes and gold nanoparticles through amino and carboxyl groups. 4-Aminohippuric acid can form stable complexes with metal ions or participate in the synthesis of nanomaterials as a reducing agent/stabilizer, enriching metal ions or giving nanoparticles peroxidase-mimicking activity. 4-Aminohippuric acid can be used to construct highly sensitive electrochemical sensors or colorimetric sensors to detect and quantitatively analyze heavy metal ions such as copper, iron, and mercury in environmental water samples and biological samples. 4-Aminohippuric acid may also be a biomarker for attention-deficit/hyperactivity disorder (ADHD) .
|
-
Cat. No. |
Product Name |
Chemical Structure |
-
- HY-B1306S
-
|
4-Aminohippuric acid-d4 (p-Aminohippuric acid-d4) is the deuterium labeled 4-Aminohippuric acid (HY-B1306). 4-Aminohippuric acid (p-Aminohippuric acid) is a coordination ligand for metal ions (such as Cu 2+, Fe 3+, Hg 2+) and a functionalization reagent for nanomaterials. 4-Aminohippuric acid can coordinate with metal ions or modify the surface of materials such as carbon nanotubes and gold nanoparticles through amino and carboxyl groups. 4-Aminohippuric acid can form stable complexes with metal ions or participate in the synthesis of nanomaterials as a reducing agent/stabilizer, enriching metal ions or giving nanoparticles peroxidase-mimicking activity. 4-Aminohippuric acid can be used to construct highly sensitive electrochemical sensors or colorimetric sensors to detect and quantitatively analyze heavy metal ions such as copper, iron, and mercury in environmental water samples and biological samples. 4-Aminohippuric acid may also be a biomarker for attention-deficit/hyperactivity disorder (ADHD) .
|
-
Cat. No. |
Product Name |
|
Classification |
-
- HY-W142596
-
|
|
Phospholipids
|
1,2-DImyristoyl-rac-glycero-3-phosphocholine (DMPC), a zwitterionic phospholipid, is chosen as a simple eukaryotic cell membrane, mimicking the neutral charge of the surface membrane of eukaryotic plasma membranes .
|
-
- HY-D2361
-
|
|
Nucleosides and their Analogs
A
|
Adenosine 2'-PEG-Biotin is a biochemical reagent derived from adenosine. Adenosine 2'-PEG-Biotin regulates cell signaling pathways by mimicking the effects of endogenous adenosine and binding to its receptors. Adenosine 2'-PEG-Biotin can be used in the research of bioprobes, biosensors and diagnostic reagents .
|
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent: