Search Result

Results for "

mimicking

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Apoptosis (2) Autophagy (1) Bacterial (2) Bcl-2 Family (1) Biochemical Assay Reagents (97) Calcium Channel (1) COX (1) Drug Metabolite (1) Endogenous Metabolite (3) Fluorescent Dye (2) FOXO (1) GLP Receptor (2) Herbicide (2) HIV (1) HPV (1) iGluR (3) Insulin Receptor (1) Integrin (1) Keap1-Nrf2 (1) Liposome (1) mAChR (1) Melanocortin Receptor (2) Microtubule/Tubulin (1) Neuropeptide Y Receptor (1) NF-κB (1) Nucleoside Antimetabolite/Analog (1) Orexin Receptor (OX Receptor) (1) Parasite (1) PDI (1) Phosphatase (1) Phytohormone (1) PKA (1) Proton Pump (1) Ras (1) SOD (1) Sodium Channel (2) Thrombin (1) TNF Receptor (1) TRP Channel (1) VEGFR (1) Wnt (3)
By Research Areas:	Cancer (8) Cardiovascular Disease (2) Infection (4) Inflammation/Immunology (1) Metabolic Disease (7) Neurological Disease (10)
Oligonucleotides:	A (1) Nucleosides and their Analogs (1) Phospholipids (1)

136

Inhibitors & Agonists

Fluorescent Dye

Biochemical Assay Reagents

Peptides

Inhibitory Antibodies

Natural
Products

Isotope-Labeled Compounds

Oligonucleotides

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P5558

KLTWQELYQLKYKGI	VEGFR	Inflammation/Immunology
KLTWQELYQLKYKGI (QK) is a VEGF mimicking peptide, binds to the VEGF receptors and competes with VEGF. KLTWQELYQLKYKGI is active in gastric ulcer healing in rodents when administered either orally or systemically. KLTWQELYQLKYKGI shows the ability to induce capillary formation and organization in vitro .

HY-P1416

Foxy-5 5+ Cited Publications	Wnt	Cancer
Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .

HY-P1416A

Foxy-5 TFA 5+ Cited Publications	Wnt	Cancer
Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .

HY-P0102

Dipeptide diaminobutyroyl benzylamide diacetate	mAChR	Neurological Disease
Dipeptide diaminobutyroyl benzylamide diacetate, a Wagerlin-1-mimicking peptide, is a mAChR antagonist. Dipeptide diaminobutyroyl benzylamide diacetate can induce muscle relaxation .

HY-112416

AZD4320 2 Publications Verification	Bcl-2 Family	Cancer
AZD4320 is a novel BH3-mimicking dual BCL2/BCLxL inhibitor with IC₅₀s of 26 nM, 17 nM, and 170 nM for KPUM-MS3, KPUM-UH1, and STR-428 cells, respectively.

HY-17551

NMDA Maximum Cited Publications 22 Publications Verification N-Methyl-D-aspartic acid	iGluR Endogenous Metabolite	Neurological Disease
NMDA is a specific agonist for NMDA receptor mimicking the action of glutamate, the neurotransmitter which normally acts at that receptor.

HY-P10428

*E6AP-mimicking* peptide**	HPV	Infection
E6AP-mimicking peptide (compound 13) is a high-affinity, selective, irreversible and potent peptide-based covalent HPV16 E6 inhibitor targeting the 16E6 oncoprotein using a cysteine-reactive acrylamide warhead. E6AP-mimicking peptide has a K_i of 17 nM. E6AP-mimicking peptide targets all residues appearing in the binding pocket of E6 to disrupt the binding interface of 16E6 and E6AP. E6AP-mimicking peptide selectively binds and crosslinks to MBP-16E6 in PBS or a protein mixture .

HY-P5171

MDGCEL	Wnt	Cancer
MDGCEL is a WNT5A peptide, that acts as a WNT5A mimicks and exhibits WNT5A antagonistic activity .

HY-167815

myo-Inositol hexasulfate hexapotassium	Biochemical Assay Reagents
Myo-Inositol hexasulfate hexapotassium is a sulfated derivative of inositol that has the activity of mimicking highly sulfated polysaccharides such as heparin, affecting many cell signaling pathways.

HY-158464

Fetuin glycoprotein	Biochemical Assay Reagents	Others
Fetuin glycoprotein is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158466

Human IgG Glycoprotein	Biochemical Assay Reagents	Others
Human IgG Glycoprotein is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-P10026

Nisotirostide LY-3457263	Neuropeptide Y Receptor	Metabolic Disease
Nisotirotide (LY-3457263) is a subcutaneous injectable NPY2 receptor agonist. By mimicking peptide YY (PYY), Nisotirotide inhibits appetite and can be used in the research of diseases such as obesity and diabetes .

HY-158528

A3 glycan A3 N-linked oligosaccharide	Biochemical Assay Reagents	Others
A3 glycan (A3 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158532

A4 glycan A4 N-linked oligosaccharide	Biochemical Assay Reagents	Others
A4 glycan (A4 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-W142596

1,2-DImyristoyl-rac-glycero-3-phosphocholine	Liposome	Others
1,2-DImyristoyl-rac-glycero-3-phosphocholine (DMPC), a zwitterionic phospholipid, is chosen as a simple eukaryotic cell membrane, mimicking the neutral charge of the surface membrane of eukaryotic plasma membranes .

HY-158494

A2 glycan (G0) A2 N-linked oligosaccharide	Biochemical Assay Reagents	Others
A2 glycan (G0) (A2 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158460

Alpha-Gal Galactose-alpha-1,3-galactose	Biochemical Assay Reagents	Others
Alpha-Gal (Galactose-alpha-1,3-galactose) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158490

A4G4 glycan A4G4 N-linked oligosaccharide	Biochemical Assay Reagents	Others
A4G4 glycan (A4G4 N-linked oligosaccharide) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158542

A4 glycan, procainamide labelled A4 N-linked oligosaccharide, procainamide labelled	Biochemical Assay Reagents	Others
A4 glycan, procainamide labelled (A4 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158531

A3 glycan, procainamide labelled A3 N-linked oligosaccharide, procainamide labelled	Fluorescent Dye Biochemical Assay Reagents	Others
A3 glycan, procainamide labelled (A3 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158472

Sialylated Core 1 O-glycan (C1S(3)1)	Biochemical Assay Reagents	Others
Sialylated Core 1 O-glycan (C1S(3)1) () is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158534

M8 glycan (Man8) Mannose-8 N-linked oligosaccharide; Oligomannose 8 glycan	Biochemical Assay Reagents	Others
M8 glycan (Man8) (Mannose-8 N-linked oligosaccharide; Oligomannose 8 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158493

A2 glycan (G0), procainamide labelled A2 N-linked oligosaccharide, procainamide labelled	Biochemical Assay Reagents	Others
A2 glycan (G0), procainamide labelled (A2 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158463

A2G2S2-KVANKT glycopeptide	Biochemical Assay Reagents	Others
A2G2S2-KVANKT glycopeptide is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158509

M6 glycan (Man6) Mannose-6 N-linked oligosaccharide; Oligomannose 6 glycan	Biochemical Assay Reagents	Others
M6 glycan (Man6) (Mannose-6 N-linked oligosaccharide; Oligomannose 6 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158497

A2 glycan (G0), APTS labelled A2 N-linked oligosaccharide, APTS labelled	Biochemical Assay Reagents	Others
A2 glycan (G0), APTS labelled (A2 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158485

M5 glycan (Man5) Mannose-5 N-linked oligosaccharide; Oligomannose 5 glycan	Biochemical Assay Reagents	Others
M5 glycan (Man5) (Mannose-5 N-linked oligosaccharide; Oligomannose 5 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-P991337

YH-002	Orexin Receptor (OX Receptor)	Cancer
YH-002 is a human IgG1 monoclonal antibody (mAb) targeting TNFRSF4/OX40/CD134. YH-002 binds to OX40 by mimicking the function of OX40L .

HY-158519

M7 glycan (Man7) Mannose-7 N-linked oligosaccharide; Oligomannose 7 glycan	Biochemical Assay Reagents	Others
M7 glycan (Man7) (Mannose-7 N-linked oligosaccharide; Oligomannose 7 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158543

M9 glycan (Man9) Mannose-9 N-linked oligosaccharide; Oligomannose 9 glycan	Biochemical Assay Reagents	Others
M9 glycan (Man9) (Mannose-9 N-linked oligosaccharide; Oligomannose 9 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158482

M3 glycan (Man3) Mannose-3 N-linked oligosaccharide; Oligomannose 3 glycan	Biochemical Assay Reagents	Others
M3 glycan (Man3) (Mannose-3 N-linked oligosaccharide; Oligomannose 3 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-119274

BN-82451 dihydrochloride	COX Sodium Channel	Neurological Disease
BN-82451 dihydrochloride, an orally active and CNS-penetrated antioxidant and a multitargeting neuroprotective agent, exert a significant protection in experimental animal models mimicking aspects of cerebral ischemia, Parkinson disease, Huntington disease, and more particularly amyotrophic lateral sclerosis .

HY-158516

M6 glycan (Man6), procainamide labelled Mannose-6 N-linked oligosaccharide, procainamide labelled; Oligomannose 6 glycan, procainamide labelled	Biochemical Assay Reagents	Others
M6 glycan (Man6), procainamide labelled (Mannose-6 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158541

A4 glycan, 2-AB labelled A4 N-linked oligosaccharide, 2-AB labelled	Fluorescent Dye Biochemical Assay Reagents	Others
A4 glycan, 2-AB labelled (A4 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158540

A4 glycan, 2-AA labelled A4 N-linked oligosaccharide, 2-AA labelled	Biochemical Assay Reagents	Others
A4 glycan, 2-AA labelled (A4 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-162467

Opabactin	Proton Pump	Others
Opabactin is an agonist for abscisic acid (ABA) receptor, which regulates the water use of plants by mimicking the effects of ABA with an IC₅₀ of 7 nM. Opabactin inhibits the seed germination of Arabidopsis with an IC₅₀ of 62 nM. Opabactin induces anti-transpiration response in plant tissue, and improves crop drought tolerance .

HY-158468

Sialylated Core 1 O-glycan (C1S(3)1), 2AB labelled	Biochemical Assay Reagents	Others
Sialylated Core 1 O-glycan (C1S(3)1), 2AB labelled () is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158529

A3 glycan, 2-AA labelled A3 N-linked oligosaccharide, 2-AA labelled	Biochemical Assay Reagents	Others
A3 glycan, 2-AA labelled (A3 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158530

A3 glycan, 2-AB labelled A3 N-linked oligosaccharide, 2-AB labelled	Biochemical Assay Reagents	Others
A3 glycan, 2-AB labelled (A3 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158498

FA2 glycan (G0F) FA2 N-linked oligosaccharide; F(6)A2 glycan	Biochemical Assay Reagents	Others
FA2 glycan (G0F) (FA2 N-linked oligosaccharide; F(6)A2 glycan) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158496

A2 glycan (G0), 2-AB labelled A2 N-linked oligosaccharide, 2-AB labelled	Biochemical Assay Reagents	Others
A2 glycan (G0), 2-AB labelled (A2 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-B0867

2,4-D Butyl ester	Herbicide	Others
2,4-D Butyl ester is an organic phenoxy herbicide and used to control woody broad-leaf weeds. 2,4-D butyl ester produces its herbicidal effect by mimicking natural plant growth hormones causing plants to grow too rapidly to survive .

HY-158446

A2G2 glycan (G2), APTS labelled A2G2 N-linked oligosaccharide, APTS labelled	Biochemical Assay Reagents	Others
A2G2 glycan (G2), APTS labelled (A2G2 N-linked oligosaccharide, APTS labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158461

Alpha-Gal standard, 2-AA labelled Galactose-alpha-1,3-galactose, 2-AA labelled	Biochemical Assay Reagents	Others
Alpha-Gal standard, 2-AA labelled (Galactose-alpha-1,3-galactose, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158462

Alpha-Gal standard, 2-AB labelled Galactose-alpha-1,3-galactose, 2-AB labelled	Biochemical Assay Reagents	Others
Alpha-Gal standard, 2-AB labelled (Galactose-alpha-1,3-galactose, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158537

A3G3S3 glycan, procainamide labelled A3G3S3 N-linked oligosaccharide, procainamide labelled	Biochemical Assay Reagents	Others
A3G3S3 glycan, procainamide labelled (A3G3S3 N-linked oligosaccharide, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158491

A4G4 glycan, 2-AA labelled A4G4 N-linked oligosaccharide, 2-AA labelled	Biochemical Assay Reagents	Others
A4G4 glycan, 2-AA labelled (A4G4 N-linked oligosaccharide, 2-AA labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158492

A4G4 glycan, 2-AB labelled A4G4 N-linked oligosaccharide, 2-AB labelled	Biochemical Assay Reagents	Others
A4G4 glycan, 2-AB labelled (A4G4 N-linked oligosaccharide, 2-AB labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158539

M8 glycan (Man8), procainamide labelled Mannose-8 N-linked oligosaccharide, procainamide labelled; Oligomannose 8 glycan, procainamide labelled	Biochemical Assay Reagents	Others
M8 glycan (Man8), procainamide labelled (Mannose-8 N-linked oligosaccharide, procainamide labelled; Oligomannose 8 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

HY-158546

M9 glycan (Man9), procainamide labelled Mannose-9 N-linked oligosaccharide, procainamide labelled; Oligomannose 9 glycan, procainamide labelled	Biochemical Assay Reagents	Others
M9 glycan (Man9), procainamide labelled (Mannose-9 N-linked oligosaccharide, procainamide labelled; Oligomannose 9 glycan, procainamide labelled) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans .

Cat. No.	Product Name	Type

HY-D2361

Adenosine 2'-PEG-Biotin	Dyes
Adenosine 2'-PEG-Biotin is a biochemical reagent derived from adenosine. Adenosine 2'-PEG-Biotin regulates cell signaling pathways by mimicking the effects of endogenous adenosine and binding to its receptors. Adenosine 2'-PEG-Biotin can be used in the research of bioprobes, biosensors and diagnostic reagents .

Cat. No.	Product Name	Target	Research Area

HY-P5558

KLTWQELYQLKYKGI	VEGFR	Inflammation/Immunology
KLTWQELYQLKYKGI (QK) is a VEGF mimicking peptide, binds to the VEGF receptors and competes with VEGF. KLTWQELYQLKYKGI is active in gastric ulcer healing in rodents when administered either orally or systemically. KLTWQELYQLKYKGI shows the ability to induce capillary formation and organization in vitro .

HY-P1416

Foxy-5 Maximum Cited Publications 6 Publications Verification	Wnt	Cancer
Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .

HY-P1416A

Foxy-5 TFA Maximum Cited Publications 6 Publications Verification	Wnt	Cancer
Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .

HY-P0102

Dipeptide diaminobutyroyl benzylamide diacetate	mAChR	Neurological Disease
Dipeptide diaminobutyroyl benzylamide diacetate, a Wagerlin-1-mimicking peptide, is a mAChR antagonist. Dipeptide diaminobutyroyl benzylamide diacetate can induce muscle relaxation .

HY-P10026

Nisotirostide LY-3457263	Neuropeptide Y Receptor	Metabolic Disease
Nisotirotide (LY-3457263) is a subcutaneous injectable NPY2 receptor agonist. By mimicking peptide YY (PYY), Nisotirotide inhibits appetite and can be used in the research of diseases such as obesity and diabetes .

HY-P10512

BDC2.5 mimotope	Peptides	Others
BDC2.5 mimotope is a potent antigen-mimicking peptide that can activate CD4+ T cell populations that have the same antigen recognition properties as BDC2.5 cells. BDC2.5 mimotope can be used to study the prevention or treatment of type 1 diabetes by targeting specific T cell populations .

HY-P10428

*E6AP-mimicking* peptide**	HPV	Infection
E6AP-mimicking peptide (compound 13) is a high-affinity, selective, irreversible and potent peptide-based covalent HPV16 E6 inhibitor targeting the 16E6 oncoprotein using a cysteine-reactive acrylamide warhead. E6AP-mimicking peptide has a K_i of 17 nM. E6AP-mimicking peptide targets all residues appearing in the binding pocket of E6 to disrupt the binding interface of 16E6 and E6AP. E6AP-mimicking peptide selectively binds and crosslinks to MBP-16E6 in PBS or a protein mixture .

HY-P5171

MDGCEL	Wnt	Cancer
MDGCEL is a WNT5A peptide, that acts as a WNT5A mimicks and exhibits WNT5A antagonistic activity .

HY-P10626

Nanodisc scaffold peptide NSPr	Peptides	Others
Nanodisc scaffold peptide (NSPr) is an amphipathic double-helical peptide that stabilizes membrane proteins by mimicking their natural environment, allowing them to remain stable and active in detergent-free aqueous solutions. Nanodisc scaffold peptide can be used to construct a universal tool for high-throughput stabilization of membrane proteins, facilitating modern biological research .

HY-P5371

TFLLRNPNDK-NH2	Thrombin	Others
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)

HY-P10356

T100-Mut	TRP Channel	Others
T100-Mut is a cell-permeable peptide whose N-terminus is conjugated with a myristoylated group to enable T100-Mut to penetrate and localize to the inner side of the plasma membrane, thus mimicking the topology of Tmem100-3Q. T100-Mut can alleviate TRPA1-mediated pain .

HY-N2466A

Melanotan I acetate MT-I acetate; [Nle4,D-Phe7]-α-MSH acetate	Melanocortin Receptor	Cancer
Melanotan I acetate is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I acetate is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I acetate can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I acetate can be used for sunlight-induced skin cancers research .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-N2466

Melanotan I 1 Publications Verification MT-I; [Nle4,D-Phe7]-α-MSH	Melanocortin Receptor	Neurological Disease Cancer
Melanotan I is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I can be used for the research of sun-induced skin cancer, melanoma, inflammation and male erectile dysfunction .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P10302

GLP-1R/GIPR agonist-1	GLP Receptor Insulin Receptor	Metabolic Disease
GLP-1R/GIPR AgonIST-1 is a double-receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulin releasing peptide). GLP-1R/GIPR agonist-1 lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .

HY-P10302A

GLP-1R/GIPR agonist-1 (soduim)	GLP Receptor	Metabolic Disease
GLP-1R/GIPR agonist-1 soduim is the sodium salt form of GLP-1R/GIPR agonist-1 (HY-P10302). GLP-1R/GIPR agonist-1 soduim is a dual agonist for glucagon-like peptide-1 receptor (GLP-1R, EC₅₀ is 0.57 nM) and glucose-dependent insulin releasing peptide receptor (GIPR, EC₅₀ is 0.75 nM). GLP-1R/GIPR agonist-1 soduim lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 soduim can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .

Cat. No.	Product Name	Target	Research Area

HY-P991337

YH-002	Orexin Receptor (OX Receptor)	Cancer
YH-002 is a human IgG1 monoclonal antibody (mAb) targeting TNFRSF4/OX40/CD134. YH-002 binds to OX40 by mimicking the function of OX40L .

HY-P991069

VRC-01	HIV	Infection
VRC-01 is a fully human IgG1 antibody that targets envelope glycoprotein gp120 Protein. VRC-01 blocks viral entry by partially mimicking the interaction of the CD4 receptor with HIV-1 gp120 envelope glycoprotein. The isotype control for VRC-01 can refer to Human IgG1 kappa, Isotype Control (HY-P99001) .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-17551

NMDA 20+ Cited Publications N-Methyl-D-aspartic acid	Structural Classification Ketones, Aldehydes, Acids Source classification Endogenous metabolite	iGluR Endogenous Metabolite
NMDA is a specific agonist for NMDA receptor mimicking the action of glutamate, the neurotransmitter which normally acts at that receptor.

HY-N11420

Coronatine	Structural Classification Microorganisms Classification of Application Fields Ketones, Aldehydes, Acids Source classification Other Diseases Disease Research Fields Agricultural Research	Bacterial Phytohormone
Coronatine is a plant growth regulator that mimicks the jasmonic acid-isoleucine conjugate (JA-Ile), targets the jasmonic acid receptor COI1, activates the jasmonic acid signaling pathway, thereby inhibiting salicylic acid (SA)-dependent defense responses. Coronatine antagonizes the stomatal closure, induces plant cell necrosis and chlorosis, interfers with plant hormone balance, thereby promoting pathogen infection .

HY-B1306

4-Aminohippuric acid 3 Publications Verification p-Aminohippuric acid	Structural Classification Classification of Application Fields Ketones, Aldehydes, Acids Source classification Other Diseases Endogenous metabolite Disease Research Fields	Biochemical Assay Reagents
4-Aminohippuric acid (p-Aminohippuric acid) is a coordination ligand for metal ions (such as Cu ²⁺, Fe ³⁺, Hg ²⁺) and a functionalization reagent for nanomaterials. 4-Aminohippuric acid can coordinate with metal ions or modify the surface of materials such as carbon nanotubes and gold nanoparticles through amino and carboxyl groups. 4-Aminohippuric acid can form stable complexes with metal ions or participate in the synthesis of nanomaterials as a reducing agent/stabilizer, enriching metal ions or giving nanoparticles peroxidase-mimicking activity. 4-Aminohippuric acid can be used to construct highly sensitive electrochemical sensors or colorimetric sensors to detect and quantitatively analyze heavy metal ions such as copper, iron, and mercury in environmental water samples and biological samples. 4-Aminohippuric acid may also be a biomarker for attention-deficit/hyperactivity disorder (ADHD) .

HY-N3021

D-chiro-Inositol	Structural Classification Natural Products Classification of Application Fields Source classification Metabolic Disease Endogenous metabolite Disease Research Fields	Endogenous Metabolite NF-κB TNF Receptor FOXO Microtubule/Tubulin
D-chiro-Inositol is a stereoisomer of inositol that exhibits activities such as improving glucose metabolism, anti-tumor effects, anti-inflammatory properties, and antioxidant activity. D-chiro-Inositol effectively alleviates cholestasis by enhancing bile acid secretion and reducing oxidative stress. D-chiro-Inositol improves insulin resistance, lowers hyperglycemia and circulating insulin levels, reduces serum androgen levels, and ameliorates some metabolic abnormalities associated with X syndrome by mimicking the action of insulin. Additionally, D-chiro-Inositol can induce a reduction in pro-inflammatory factors (such as Nf-κB) and cytokines (such as TNF-α), thereby exerting anti-inflammatory effects. D-chiro-Inositol may be used in the study of liver cirrhosis, breast cancer, type 2 diabetes, and polycystic ovary syndrome .

HY-B1306R

4-Aminohippuric acid (Standard) p-Aminohippuric acid (Standard)	Structural Classification Ketones, Aldehydes, Acids Source classification Endogenous metabolite	Biochemical Assay Reagents
4-Aminohippuric acid (p-Aminohippuric acid) (Standard) is the analytical standard of 4-Aminohippuric acid (HY-B1306). This product is intended for research and analytical applications. 4-Aminohippuric acid (p-Aminohippuric acid) is a coordination ligand for metal ions (such as Cu ²⁺, Fe ³⁺, Hg ²⁺) and a functionalization reagent for nanomaterials. 4-Aminohippuric acid can coordinate with metal ions or modify the surface of materials such as carbon nanotubes and gold nanoparticles through amino and carboxyl groups. 4-Aminohippuric acid can form stable complexes with metal ions or participate in the synthesis of nanomaterials as a reducing agent/stabilizer, enriching metal ions or giving nanoparticles peroxidase-mimicking activity. 4-Aminohippuric acid can be used to construct highly sensitive electrochemical sensors or colorimetric sensors to detect and quantitatively analyze heavy metal ions such as copper, iron, and mercury in environmental water samples and biological samples. 4-Aminohippuric acid may also be a biomarker for attention-deficit/hyperactivity disorder (ADHD) .

Cat. No.	Product Name	Chemical Structure

HY-B1306S

4-Aminohippuric acid-d4

4-Aminohippuric acid-d₄ (p-Aminohippuric acid-d₄) is the deuterium labeled 4-Aminohippuric acid (HY-B1306). 4-Aminohippuric acid (p-Aminohippuric acid) is a coordination ligand for metal ions (such as Cu ²⁺, Fe ³⁺, Hg ²⁺) and a functionalization reagent for nanomaterials. 4-Aminohippuric acid can coordinate with metal ions or modify the surface of materials such as carbon nanotubes and gold nanoparticles through amino and carboxyl groups. 4-Aminohippuric acid can form stable complexes with metal ions or participate in the synthesis of nanomaterials as a reducing agent/stabilizer, enriching metal ions or giving nanoparticles peroxidase-mimicking activity. 4-Aminohippuric acid can be used to construct highly sensitive electrochemical sensors or colorimetric sensors to detect and quantitatively analyze heavy metal ions such as copper, iron, and mercury in environmental water samples and biological samples. 4-Aminohippuric acid may also be a biomarker for attention-deficit/hyperactivity disorder (ADHD) .

Cat. No.	Product Name		Classification