1. Search Result
Search Result
Results for "

amino-acid peptide

" in MedChemExpress (MCE) Product Catalog:

37

Inhibitors & Agonists

39

Peptides

5

Natural
Products

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-P3581

    Potassium Channel Neurological Disease
    PE 22-28 is a TREK-1 inhibitor with IC50 value of 0.12 nM. PE 22-28 also is a 7 amino-acid peptide that is used as a core sequence for preparing analogs by chemical modifications and also by substitution of amino-acids. PE 22-28 can be used for the research of depression .
    PE 22-28
  • HY-P0173A
    Chlorotoxin
    2 Publications Verification

    Chloride Channel Cancer
    Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
    Chlorotoxin
  • HY-P1856
    Proinsulin C-peptide (human)
    1 Publications Verification

    Insulin Receptor Metabolic Disease
    Proinsulin C-peptide (human) is a 31-amino-acid peptide that links the A and B chains of proinsulin, ensuring its correct folding, which is biologically active and modulates cellular function .
    Proinsulin C-peptide (human)
  • HY-P10651

    Biochemical Assay Reagents Others
    Lifeact peptide is a 17-amino-acid sequence derived from an actin-binding domain of yeasts. Lifeact peptide can specifically bind to actin microfilaments and can be used for the labeling of actin .
    Lifeact peptide
  • HY-P5354

    Fluorescent Dye Others
    FRETS-VWF73, a 73-amino-acid peptide, is a fluorogenic substrate for ADAMTS13 assay (Ex=340 nm; Em=450 nm) .
    FRETS-VWF73
  • HY-P5354A

    Fluorescent Dye Others
    FRETS-VWF73 TFA, a 73-amino-acid peptide, is a fluorogenic substrate for ADAMTS13 assay (Ex=340 nm; Em=450 nm) .
    FRETS-VWF73 TFA
  • HY-P1511

    PACAP Receptor Neurological Disease
    PACAP-Related Peptide (PRP), human is a 29 amino-acid region of the PACAP precursor protein.
    PACAP-Related Peptide (PRP), human
  • HY-P0173

    Chloride Channel Cancer
    Chlorotoxin(linear) is a linear 36 amino-acid peptide which can be used in Chlorotoxin related research.
    Chlorotoxin(linear)
  • HY-P2534

    Insulin Receptor Metabolic Disease
    C-Peptide 2, rat, 31-amino-acid peptide, is a component of proinsulin. C-Peptide 2, rat can inhibit glucose-induced insulin secretion .
    C-Peptide 2, rat
  • HY-P10814

    Bacterial Infection
    MciZ (B. subtilis), a 40-amino-acid peptide, inhibits the GTPase activity of FtsZ that prevents inappropriate Z-ring formation during sporulation .
    MciZ (B. subtilis)
  • HY-P2207

    Biochemical Assay Reagents Others
    Sinapultide is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide can be used for synthetic phospholipids surfactants improvement .
    Sinapultide
  • HY-P2526
    LyP-1
    2 Publications Verification

    Complement System Cancer
    LyP-1 is a cyclic 9-amino-acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
    LyP-1
  • HY-P3811A

    CaMK Neurological Disease
    Autocamtide-3 acetate, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
    Autocamtide-3 acetate
  • HY-P3811

    CaMK Neurological Disease
    Autocamtide-3, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
    Autocamtide-3
  • HY-P2207A

    Biochemical Assay Reagents Others
    Sinapultide TFA is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide TFA can be used for synthetic phospholipids surfactants improvement .
    Sinapultide TFA
  • HY-P0285
    Rabies Virus Glycoprotein
    1 Publications Verification

    RABV Infection
    Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.
    Rabies Virus Glycoprotein
  • HY-N5191

    Antibiotic Bacterial Infection
    Epidermin is a type A lantibiotic that is a tetracyclic 21-amino-acid peptide. Epidermin exhibits antibiotic activity against many Gram-positive bacteria. Epidermin has a role as a metabolite and an antibacterial agent .
    Epidermin
  • HY-P0285A
    Rabies Virus Glycoprotein TFA
    1 Publications Verification

    RABV Infection
    Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells .
    Rabies Virus Glycoprotein TFA
  • HY-P1714

    FE 203799

    GLP Receptor Metabolic Disease
    Apraglutide (FE 203799), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
    Apraglutide
  • HY-P10825

    DNA/RNA Synthesis Cancer
    p21PBP, a 20 amino-acid peptide, is an inhibitor of DNA replication. p21PBP specifically binds to purified proliferating cell nuclear antigen (PCNA) in tumour cell extracts. p21PBP is promising for research of cancers .
    p21PBP
  • HY-P1714A

    FE 203799 TFA

    GLP Receptor Metabolic Disease
    Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
    Apraglutide TFA
  • HY-P2230
    Angstrom6
    1 Publications Verification

    A6 peptide

    PAI-1 Cancer
    Angstrom6 (A6 Peptide) is an 8 amino-acid peptide derived from single-chain urokinase plasminogen activator (scuPA) and interferes with the uPA/uPAR cascade and abrogates downstream effects. Angstrom6 binds to CD44 resulting in the inhibition of migration, invasion, and metastasis of tumor cells, and the modulation of CD44-mediated cell signaling .
    Angstrom6
  • HY-P1293

    iGluR Neurological Disease
    Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G has neuroprotective properties .
    Conantokin G
  • HY-P1293A

    iGluR Neurological Disease
    Conantokin G TFA, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G TFA inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G TFA has neuroprotective properties .
    Conantokin G TFA
  • HY-P3431

    iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
  • HY-P4146

    BI 456906

    GLP Receptor GCGR Metabolic Disease
    Survodutide (BI 456906) is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC50s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .
    Survodutide
  • HY-P3431A

    iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
  • HY-P1674

    POL7080

    Bacterial Antibiotic Infection
    Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC50 and MIC90 values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
    Murepavadin
  • HY-P1674A
    Murepavadin TFA
    2 Publications Verification

    POL7080 TFA

    Bacterial Antibiotic Infection
    Murepavadin (POL7080) (TFA), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with MIC50 and MIC90 values both of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
    Murepavadin TFA
  • HY-P4146A

    BI 456906 TFA

    GLP Receptor GCGR Metabolic Disease
    Survodutide (BI 456906) TFA is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC50s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide TFA, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide TFA has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .
    Survodutide TFA
  • HY-P1654

    Integrin Cancer
    A20FMDV2 is a selective αvβ6 integrin inhibitor (IC50: 3 nM), with an activity 1,000-fold more selective for αvβ6 than for other RGD-directed integrins (αvβ3, αvβ5, and α5β1). A20FMDV2 can be derived from foot-and-mouth disease virus and is a 20-amino-acid peptide. A20FMDV2 can be radiolabeled for the PET imaging of αvβ6 integrin-positive tumors .
    A20FMDV2
  • HY-P10827

    Complement System Inflammation/Immunology
    PIC1 PA, a 15 amino-acid peptide, is a potent PIC1 analog that inhibits classical pathway mediated complement activation. PIC1 PA functionally disrupts the C1s-C1r-C1r-C1s/MASPs interaction with collagen-like region (CLR) of C1q/MBL, respectively. PIC1 PA specifically binds to the CLR of C1q and bounds to purified C1q with a mean equilibrium dissociation constant (KD) of 33.3 nM .
    PIC1 PA
  • HY-P4201

    Vasopressin Receptor Cardiovascular Disease
    JKC 301 is a selective Endothelin A receptor antagonist. JKC 301 attenuates the pressor effects of nicotine in rats. JKC 301 can be used to study cardiovascular disease caused by smoking .
    JKC 301
  • HY-P10052

    VEGFR Cancer
    CBO-P11 specifically binds to receptor of VEGFR-2 and is used as targeting ligand for tumor angiogenesis. CBO-P11 is modified with a nearinfrared cyanine dye bearing an alkyne function, allowing both “click” coupling on azido-modified nanoparticles and fluorescence labelling .
    CBO-P11
  • HY-P10053

    Phospholipase Metabolic Disease
    sPLA2-IIA Inhibitor is a cyclic pentapeptide analog of FLSYK (cyclic 2-Nal-Leu-Ser-2-Nal-Arg (c2)), that binds to hGIIA (human IIA phospholipase A2) and inhibits its hydrolytic ability. sPLA2 is a member of the esterase superfamily that catalyzes the hydrolysis of the ester bond at the sn-2 position of glycerophospholipids, releasing free fatty acids such as arachidonic acid and lysophospholipids .
    sPLA2-IIA Inhibitor
  • HY-P10051

    Ras Raf Cancer
    Cyclorasin 9A5 is an 11-residue cell-permeable cyclic peptide that orthosterically inhibits the Ras-Raf protein interaction with an IC50 of 120 nM .
    Cyclorasin 9A5
  • HY-P11236

    LS301

    Biochemical Assay Reagents Others
    Cronexitide lanocianine is a diagnostic imaging agent.
    Cronexitide lanocianine

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: