Search Result
Results for "
amino-acid peptide
" in MedChemExpress (MCE) Product Catalog:
| Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-P3581
-
|
|
Potassium Channel
|
Neurological Disease
|
|
PE 22-28 is a TREK-1 inhibitor with IC50 value of 0.12 nM. PE 22-28 also is a 7 amino-acid peptide that is used as a core sequence for preparing analogs by chemical modifications and also by substitution of amino-acids. PE 22-28 can be used for the research of depression .
|
-
-
- HY-P0173A
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
-
-
- HY-P1856
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
Proinsulin C-peptide (human) is a 31-amino-acid peptide that links the A and B chains of proinsulin, ensuring its correct folding, which is biologically active and modulates cellular function .
|
-
-
- HY-P10651
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Lifeact peptide is a 17-amino-acid sequence derived from an actin-binding domain of yeasts. Lifeact peptide can specifically bind to actin microfilaments and can be used for the labeling of actin .
|
-
-
- HY-P5354
-
|
|
Fluorescent Dye
|
Others
|
|
FRETS-VWF73, a 73-amino-acid peptide, is a fluorogenic substrate for ADAMTS13 assay (Ex=340 nm; Em=450 nm) .
|
-
-
- HY-P5354A
-
|
|
Fluorescent Dye
|
Others
|
|
FRETS-VWF73 TFA, a 73-amino-acid peptide, is a fluorogenic substrate for ADAMTS13 assay (Ex=340 nm; Em=450 nm) .
|
-
-
- HY-P1511
-
-
-
- HY-P0173
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin(linear) is a linear 36 amino-acid peptide which can be used in Chlorotoxin related research.
|
-
-
- HY-P2534
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
C-Peptide 2, rat, 31-amino-acid peptide, is a component of proinsulin. C-Peptide 2, rat can inhibit glucose-induced insulin secretion .
|
-
-
- HY-P10814
-
|
|
Bacterial
|
Infection
|
|
MciZ (B. subtilis), a 40-amino-acid peptide, inhibits the GTPase activity of FtsZ that prevents inappropriate Z-ring formation during sporulation .
|
-
-
- HY-P2207
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Sinapultide is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide can be used for synthetic phospholipids surfactants improvement .
|
-
-
- HY-P2526
-
LyP-1
2 Publications Verification
|
Complement System
|
Cancer
|
|
LyP-1 is a cyclic 9-amino-acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
-
-
- HY-P3811A
-
|
|
CaMK
|
Neurological Disease
|
|
Autocamtide-3 acetate, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
|
-
-
- HY-P3811
-
|
|
CaMK
|
Neurological Disease
|
|
Autocamtide-3, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
|
-
-
- HY-P2207A
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Sinapultide TFA is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide TFA can be used for synthetic phospholipids surfactants improvement .
|
-
-
- HY-P0285
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.
|
-
-
- HY-N5191
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
Epidermin is a type A lantibiotic that is a tetracyclic 21-amino-acid peptide. Epidermin exhibits antibiotic activity against many Gram-positive bacteria. Epidermin has a role as a metabolite and an antibacterial agent .
|
-
-
- HY-P0285A
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells .
|
-
-
- HY-P1714
-
|
FE 203799
|
GLP Receptor
|
Metabolic Disease
|
|
Apraglutide (FE 203799), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
-
-
- HY-P10825
-
|
|
DNA/RNA Synthesis
|
Cancer
|
|
p21PBP, a 20 amino-acid peptide, is an inhibitor of DNA replication. p21PBP specifically binds to purified proliferating cell nuclear antigen (PCNA) in tumour cell extracts. p21PBP is promising for research of cancers .
|
-
-
- HY-P1714A
-
|
FE 203799 TFA
|
GLP Receptor
|
Metabolic Disease
|
|
Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
-
-
- HY-P2230
-
|
A6 peptide
|
PAI-1
|
Cancer
|
|
Angstrom6 (A6 Peptide) is an 8 amino-acid peptide derived from single-chain urokinase plasminogen activator (scuPA) and interferes with the uPA/uPAR cascade and abrogates downstream effects. Angstrom6 binds to CD44 resulting in the inhibition of migration, invasion, and metastasis of tumor cells, and the modulation of CD44-mediated cell signaling .
|
-
-
- HY-P1293
-
|
|
iGluR
|
Neurological Disease
|
|
Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G has neuroprotective properties .
|
-
-
- HY-P1293A
-
|
|
iGluR
|
Neurological Disease
|
|
Conantokin G TFA, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G TFA inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G TFA has neuroprotective properties .
|
-
-
- HY-P3431
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
-
- HY-P4146
-
|
BI 456906
|
GLP Receptor
GCGR
|
Metabolic Disease
|
|
Survodutide (BI 456906) is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC50s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .
|
-
-
- HY-P3431A
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
-
- HY-P1674
-
|
POL7080
|
Bacterial
Antibiotic
|
Infection
|
|
Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC50 and MIC90 values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
|
-
-
- HY-P1674A
-
|
POL7080 TFA
|
Bacterial
Antibiotic
|
Infection
|
|
Murepavadin (POL7080) (TFA), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with MIC50 and MIC90 values both of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
|
-
-
- HY-P4146A
-
|
BI 456906 TFA
|
GLP Receptor
GCGR
|
Metabolic Disease
|
|
Survodutide (BI 456906) TFA is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC50s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide TFA, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide TFA has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .
|
-
-
- HY-P1654
-
|
|
Integrin
|
Cancer
|
|
A20FMDV2 is a selective αvβ6 integrin inhibitor (IC50: 3 nM), with an activity 1,000-fold more selective for αvβ6 than for other RGD-directed integrins (αvβ3, αvβ5, and α5β1). A20FMDV2 can be derived from foot-and-mouth disease virus and is a 20-amino-acid peptide. A20FMDV2 can be radiolabeled for the PET imaging of αvβ6 integrin-positive tumors .
|
-
-
- HY-P10827
-
|
|
Complement System
|
Inflammation/Immunology
|
|
PIC1 PA, a 15 amino-acid peptide, is a potent PIC1 analog that inhibits classical pathway mediated complement activation. PIC1 PA functionally disrupts the C1s-C1r-C1r-C1s/MASPs interaction with collagen-like region (CLR) of C1q/MBL, respectively. PIC1 PA specifically binds to the CLR of C1q and bounds to purified C1q with a mean equilibrium dissociation constant (KD) of 33.3 nM .
|
-
-
- HY-P4201
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
JKC 301 is a selective Endothelin A receptor antagonist. JKC 301 attenuates the pressor effects of nicotine in rats. JKC 301 can be used to study cardiovascular disease caused by smoking .
|
-
-
- HY-P10052
-
|
|
VEGFR
|
Cancer
|
|
CBO-P11 specifically binds to receptor of VEGFR-2 and is used as targeting ligand for tumor angiogenesis. CBO-P11 is modified with a nearinfrared cyanine dye bearing an alkyne function, allowing both “click” coupling on azido-modified nanoparticles and fluorescence labelling .
|
-
-
- HY-P10053
-
|
|
Phospholipase
|
Metabolic Disease
|
|
sPLA2-IIA Inhibitor is a cyclic pentapeptide analog of FLSYK (cyclic 2-Nal-Leu-Ser-2-Nal-Arg (c2)), that binds to hGIIA (human IIA phospholipase A2) and inhibits its hydrolytic ability. sPLA2 is a member of the esterase superfamily that catalyzes the hydrolysis of the ester bond at the sn-2 position of glycerophospholipids, releasing free fatty acids such as arachidonic acid and lysophospholipids .
|
-
-
- HY-P10051
-
|
|
Ras
Raf
|
Cancer
|
|
Cyclorasin 9A5 is an 11-residue cell-permeable cyclic peptide that orthosterically inhibits the Ras-Raf protein interaction with an IC50 of 120 nM .
|
-
-
- HY-P11236
-
-
| Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P3581
-
|
|
Potassium Channel
|
Neurological Disease
|
|
PE 22-28 is a TREK-1 inhibitor with IC50 value of 0.12 nM. PE 22-28 also is a 7 amino-acid peptide that is used as a core sequence for preparing analogs by chemical modifications and also by substitution of amino-acids. PE 22-28 can be used for the research of depression .
|
-
- HY-P0173A
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
-
- HY-P1856
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
Proinsulin C-peptide (human) is a 31-amino-acid peptide that links the A and B chains of proinsulin, ensuring its correct folding, which is biologically active and modulates cellular function .
|
-
- HY-P10651
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Lifeact peptide is a 17-amino-acid sequence derived from an actin-binding domain of yeasts. Lifeact peptide can specifically bind to actin microfilaments and can be used for the labeling of actin .
|
-
- HY-P5354
-
|
|
Fluorescent Dye
|
Others
|
|
FRETS-VWF73, a 73-amino-acid peptide, is a fluorogenic substrate for ADAMTS13 assay (Ex=340 nm; Em=450 nm) .
|
-
- HY-P3611
-
|
|
Peptides
|
Metabolic Disease
|
|
Valosin (porcine) is a biologically active peptide with 25-amino-acid. Valosin (porcine) can be isolated recently from pig intestine. Valosin (porcine) can be used for the research of digestive system .
|
-
- HY-P1511
-
-
- HY-P0173
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin(linear) is a linear 36 amino-acid peptide which can be used in Chlorotoxin related research.
|
-
- HY-P2534
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
C-Peptide 2, rat, 31-amino-acid peptide, is a component of proinsulin. C-Peptide 2, rat can inhibit glucose-induced insulin secretion .
|
-
- HY-P10814
-
|
|
Bacterial
|
Infection
|
|
MciZ (B. subtilis), a 40-amino-acid peptide, inhibits the GTPase activity of FtsZ that prevents inappropriate Z-ring formation during sporulation .
|
-
- HY-P5354A
-
|
|
Fluorescent Dye
|
Others
|
|
FRETS-VWF73 TFA, a 73-amino-acid peptide, is a fluorogenic substrate for ADAMTS13 assay (Ex=340 nm; Em=450 nm) .
|
-
- HY-P2207
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Sinapultide is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide can be used for synthetic phospholipids surfactants improvement .
|
-
- HY-P2526
-
LyP-1
2 Publications Verification
|
Complement System
|
Cancer
|
|
LyP-1 is a cyclic 9-amino-acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
-
- HY-P3811A
-
|
|
CaMK
|
Neurological Disease
|
|
Autocamtide-3 acetate, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
|
-
- HY-P3811
-
|
|
CaMK
|
Neurological Disease
|
|
Autocamtide-3, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
|
-
- HY-P2207A
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Sinapultide TFA is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide TFA can be used for synthetic phospholipids surfactants improvement .
|
-
- HY-P0285
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.
|
-
- HY-P10643
-
|
|
Peptides
|
Infection
|
|
Skeletal muscle-targeted peptide MSP is a 7-amino-acid (ASSLNIA) muscle-targeting peptide (MTP). Skeletal muscle-targeted peptide MSP can target the virus through a different binding ligand to the muscle. Skeletal muscle-targeted peptide MSP can be used for the research of diseases of the heart and skeletal muscles .
|
-
- HY-P0285A
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells .
|
-
- HY-P1714
-
|
FE 203799
|
GLP Receptor
|
Metabolic Disease
|
|
Apraglutide (FE 203799), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
-
- HY-P10825
-
|
|
DNA/RNA Synthesis
|
Cancer
|
|
p21PBP, a 20 amino-acid peptide, is an inhibitor of DNA replication. p21PBP specifically binds to purified proliferating cell nuclear antigen (PCNA) in tumour cell extracts. p21PBP is promising for research of cancers .
|
-
- HY-P1714A
-
|
FE 203799 TFA
|
GLP Receptor
|
Metabolic Disease
|
|
Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
-
- HY-P2230
-
|
A6 peptide
|
PAI-1
|
Cancer
|
|
Angstrom6 (A6 Peptide) is an 8 amino-acid peptide derived from single-chain urokinase plasminogen activator (scuPA) and interferes with the uPA/uPAR cascade and abrogates downstream effects. Angstrom6 binds to CD44 resulting in the inhibition of migration, invasion, and metastasis of tumor cells, and the modulation of CD44-mediated cell signaling .
|
-
- HY-P1293
-
|
|
iGluR
|
Neurological Disease
|
|
Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G has neuroprotective properties .
|
-
- HY-P1293A
-
|
|
iGluR
|
Neurological Disease
|
|
Conantokin G TFA, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G TFA inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G TFA has neuroprotective properties .
|
-
- HY-P3431
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P4146
-
|
BI 456906
|
GLP Receptor
GCGR
|
Metabolic Disease
|
|
Survodutide (BI 456906) is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC50s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .
|
-
- HY-P3431A
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P1674
-
|
POL7080
|
Bacterial
Antibiotic
|
Infection
|
|
Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC50 and MIC90 values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
|
-
- HY-P1674A
-
|
POL7080 TFA
|
Bacterial
Antibiotic
|
Infection
|
|
Murepavadin (POL7080) (TFA), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with MIC50 and MIC90 values both of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
|
-
- HY-P4146A
-
|
BI 456906 TFA
|
GLP Receptor
GCGR
|
Metabolic Disease
|
|
Survodutide (BI 456906) TFA is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC50s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide TFA, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide TFA has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .
|
-
- HY-P1654
-
|
|
Integrin
|
Cancer
|
|
A20FMDV2 is a selective αvβ6 integrin inhibitor (IC50: 3 nM), with an activity 1,000-fold more selective for αvβ6 than for other RGD-directed integrins (αvβ3, αvβ5, and α5β1). A20FMDV2 can be derived from foot-and-mouth disease virus and is a 20-amino-acid peptide. A20FMDV2 can be radiolabeled for the PET imaging of αvβ6 integrin-positive tumors .
|
-
- HY-P10827
-
|
|
Complement System
|
Inflammation/Immunology
|
|
PIC1 PA, a 15 amino-acid peptide, is a potent PIC1 analog that inhibits classical pathway mediated complement activation. PIC1 PA functionally disrupts the C1s-C1r-C1r-C1s/MASPs interaction with collagen-like region (CLR) of C1q/MBL, respectively. PIC1 PA specifically binds to the CLR of C1q and bounds to purified C1q with a mean equilibrium dissociation constant (KD) of 33.3 nM .
|
-
- HY-P0046
-
|
GHK; Tripeptide-1
|
Peptides
|
Neurological Disease
Inflammation/Immunology
|
|
Glycyl-L-histidyl-L-lysine is a tripeptide consisting of glycine, L-histidine and L-lysine residues joined in sequence. Glycyl-L-histidyl-L-lysine is a hepatotropic immunosuppressor and shows anxiolytic effect. Glycyl-L-histidyl-L-lysine and its copper complexes show good skin tolerance .
|
-
- HY-P4201
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
JKC 301 is a selective Endothelin A receptor antagonist. JKC 301 attenuates the pressor effects of nicotine in rats. JKC 301 can be used to study cardiovascular disease caused by smoking .
|
-
- HY-P10052
-
|
|
VEGFR
|
Cancer
|
|
CBO-P11 specifically binds to receptor of VEGFR-2 and is used as targeting ligand for tumor angiogenesis. CBO-P11 is modified with a nearinfrared cyanine dye bearing an alkyne function, allowing both “click” coupling on azido-modified nanoparticles and fluorescence labelling .
|
-
- HY-P10053
-
|
|
Phospholipase
|
Metabolic Disease
|
|
sPLA2-IIA Inhibitor is a cyclic pentapeptide analog of FLSYK (cyclic 2-Nal-Leu-Ser-2-Nal-Arg (c2)), that binds to hGIIA (human IIA phospholipase A2) and inhibits its hydrolytic ability. sPLA2 is a member of the esterase superfamily that catalyzes the hydrolysis of the ester bond at the sn-2 position of glycerophospholipids, releasing free fatty acids such as arachidonic acid and lysophospholipids .
|
-
- HY-P10051
-
|
|
Ras
Raf
|
Cancer
|
|
Cyclorasin 9A5 is an 11-residue cell-permeable cyclic peptide that orthosterically inhibits the Ras-Raf protein interaction with an IC50 of 120 nM .
|
-
- HY-P11236
-
| Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
-
- HY-P0173A
-
-
-
- HY-P0285
-
-
-
- HY-N5191
-
-
-
- HY-P1293
-
|
|
Natural Products
Animals
Source classification
|
iGluR
|
|
Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G has neuroprotective properties .
|
-
-
- HY-P1293A
-
|
|
Natural Products
Animals
Source classification
|
iGluR
|
|
Conantokin G TFA, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G TFA inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G TFA has neuroprotective properties .
|
-
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent: