Search Result

Results for "

amino-acid

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Amino Acid Decarboxylase (2) Amino Acid Derivatives (1310) EAAT (1) 5-HT Receptor (2) ADC Linker (2) Akt (1) Aminoacyl-tRNA Synthetase (1) Aminopeptidase (1) AMPK (1) Amylin Receptor (2) Amyloid-β (2) Angiotensin-converting Enzyme (ACE) (2) Antibiotic (5) Apoptosis (7) Autophagy (4) Bacterial (14) Bcl-2 Family (2) Biochemical Assay Reagents (40) Calcium Channel (1) CaMK (2) Carboxypeptidase (1) Caspase (2) Cathepsin (2) CD38 (1) CGRP Receptor (2) Chloride Channel (2) Cholinesterase (ChE) (1) Complement System (2) CRFR (2) CXCR (3) Dipeptidyl Peptidase (1) DNA/RNA Synthesis (1) Dopamine Receptor (1) Drug Derivative (14) Drug Intermediate (10) Drug Metabolite (4) Endogenous Metabolite (31) Endothelin Receptor (1) Factor Xa (1) Ferroportin (1) Ferroptosis (2) Fluorescent Dye (5) Fungal (2) GABA Receptor (2) GCGR (13) GLP Receptor (17) Glycosidase (1) GnRH Receptor (1) HCV (1) HIV (1) HPV (1) HSV (1) iGluR (6) Influenza Virus (1) Insulin Receptor (3) Integrin (2) Interleukin Related (1) Isotope-Labeled Compounds (3) Keap1-Nrf2 (3) Liposome (1) Lipoxygenase (1) MARCKS (2) MCHR1 (GPR24) (2) Melanocortin Receptor (1) MMP (3) Monocarboxylate Transporter (1) mTOR (1) nAChR (1) Natriuretic Peptide Receptor (NPR) (1) Neurokinin Receptor (1) NF-κB (1) NO Synthase (3) Oxytocin Receptor (1) P-glycoprotein (1) p62 (1) PACAP Receptor (1) PAI-1 (1) Parasite (1) PD-1/PD-L1 (2) Peptide-Drug Conjugates (PDCs) (1) Phosphatase (1) Phospholipase (3) PKC (2) PKG (1) Potassium Channel (2) Protease Activated Receptor (PAR) (1) Proteasome (1) PSMA (1) RABV (2) Radionuclide-Drug Conjugates (RDCs) (3) Raf (1) Ras (1) Reactive Oxygen Species (ROS) (6) Reference Standards (21) Renin (1) ROS Kinase (1) Ser/Thr Protease (2) Somatostatin Receptor (3) Src (1) STAT (2) Survivin (1) Taste Receptor (1) Thyroid Hormone Receptor (1) TRP Channel (2) Tryptophan Hydroxylase (1) Tyrosine Hydroxylase (1) Vasopressin Receptor (5) VEGFR (1) γ-Glutamyl Transferase (GGT) (1)
By Research Areas:	Cancer (44) Cardiovascular Disease (14) Endocrinology (8) Infection (25) Inflammation/Immunology (20) Metabolic Disease (58) Neurological Disease (40)
Click Chemistry:	Azide (3) Alkynes (6)

1551

Inhibitors & Agonists

Fluorescent Dye

Biochemical Assay Reagents

1590

Peptides

Natural
Products

Isotope-Labeled Compounds

Antibodies

Click Chemistry

Targets Recommended: Amino acid Transporter Amino Acid Decarboxylase Amino Acid Oxidase Amino Acid Derivatives EAAT Hydroxycarboxylic Acid Receptor (HCAR) Free Fatty Acid Receptor Fatty Acid Synthase (FASN) Apical Sodium-Dependent Bile Acid Transporter G protein-coupled Bile Acid Receptor 1

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P3581

PE 22-28	Potassium Channel	Neurological Disease
PE 22-28 is a TREK-1 inhibitor with IC₅₀ value of 0.12 nM. PE 22-28 also is a 7 amino-acid peptide that is used as a core sequence for preparing analogs by chemical modifications and also by substitution of amino-acids. PE 22-28 can be used for the research of depression .

HY-P4928

Biotinyl-Amylin (mouse, rat)	Amylin Receptor	Metabolic Disease
Biotinyl-Amylin (mouse, rat) is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .

HY-P4928A

Biotinyl-Amylin (mouse, rat) TFA	Amylin Receptor	Metabolic Disease
Biotinyl-Amylin (mouse, rat) TFA is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .

HY-P0173A

Chlorotoxin 1 Publications Verification	Chloride Channel	Cancer
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.

HY-P2207

Sinapultide	Biochemical Assay Reagents	Others
Sinapultide is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide can be used for synthetic phospholipids surfactants improvement .

HY-P3811A

Autocamtide-3 acetate	CaMK	Neurological Disease
Autocamtide-3 acetate, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca ²⁺/calmodulin-dependent kinase II) (CaMK) substrate .

HY-P1511

PACAP-Related Peptide (PRP), human	PACAP Receptor	Neurological Disease
PACAP-Related Peptide (PRP), human is a 29 amino-acid region of the PACAP precursor protein.

HY-P0173

Chlorotoxin(linear)	Chloride Channel	Cancer
Chlorotoxin(linear) is a linear 36 amino-acid peptide which can be used in Chlorotoxin related research.

HY-P10814

MciZ (B. subtilis)	Bacterial	Infection
MciZ (B. subtilis), a 40-amino-acid peptide, inhibits the GTPase activity of FtsZ that prevents inappropriate Z-ring formation during sporulation .

HY-P5354

FRETS-VWF73	Fluorescent Dye	Others
FRETS-VWF73, a 73-amino-acid peptide, is a fluorogenic substrate for ADAMTS13 assay (Ex=340 nm; Em=450 nm). .

HY-P2534

C-Peptide 2, rat	Insulin Receptor	Metabolic Disease
C-Peptide 2, rat, 31-amino-acid peptide, is a component of proinsulin. C-Peptide 2, rat can inhibit glucose-induced insulin secretion .

HY-P3811

Autocamtide-3	CaMK	Neurological Disease
Autocamtide-3, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca ²⁺/calmodulin-dependent kinase II) (CaMK) substrate .

HY-P2526

LyP-1 2 Publications Verification	Complement System	Cancer
LyP-1 is a cyclic 9-amino-acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .

HY-P1856

Proinsulin C-peptide (human)	Insulin Receptor	Metabolic Disease
Proinsulin C-peptide (human) is a 31-amino-acid peptide that links the A and B chains of proinsulin, ensuring its correct folding, which is biologically active and modulates cellular function .

HY-P2207A

Sinapultide TFA	Biochemical Assay Reagents	Others
Sinapultide TFA is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide TFA can be used for synthetic phospholipids surfactants improvement .

HY-P0285

Rabies Virus Glycoprotein 1 Publications Verification	RABV	Infection
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.

HY-N5191

Epidermin	Antibiotic Bacterial	Infection
Epidermin is a type A lantibiotic that is a tetracyclic 21-amino-acid peptide. Epidermin exhibits antibiotic activity against many Gram-positive bacteria. Epidermin has a role as a metabolite and an antibacterial agent .

HY-P10651

Lifeact peptide	Biochemical Assay Reagents	Others
Lifeact peptide is a 17-amino-acid sequence derived from an actin-binding domain of yeasts. Lifeact peptide can specifically bind to actin microfilaments and can be used for the labeling of actin .

HY-P0285A

Rabies Virus Glycoprotein TFA 1 Publications Verification	RABV	Infection
Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells .

HY-111149A

PS372424 hydrochloride 1 Publications Verification	CXCR	Inflammation/Immunology
PS372424 hydrochloride, a three amino-acid fragment of CXCL10, is a specific human CXCR3 agonist with anti-inflammatory activity. PS372424 hydrochloride prevents human T-cell migration in a humanized model of arthritic inflammation .

HY-111149

PS372424	CXCR	Inflammation/Immunology
PS372424, a three amino-acid fragment of CXCL10, is a specific human CXCR3 agonist with anti-inflammatory activity. PS372424 prevents human T-cell migration in a humanized model of arthritic inflammation .

HY-P1714

Apraglutide FE 203799	GLP Receptor	Metabolic Disease
Apraglutide (FE 203799), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .

HY-P10825

p21PBP	DNA/RNA Synthesis	Cancer
p21PBP, a 20 amino-acid peptide, is an inhibitor of DNA replication. p21PBP specifically binds to purified proliferating cell nuclear antigen (PCNA) in tumour cell extracts. p21PBP is promising for research of cancers .

HY-P10126

Osteocalcin, bovine	Endogenous Metabolite	Others
Osteocalcin, bovine is a vitamin K-dependent bone specific protein. Osteocalcin, bovine is also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP). Osteocalcin, bovine is a small (49-amino-acid) noncollagenous protein hormone .

HY-P1714A

Apraglutide TFA FE 203799 TFA	GLP Receptor	Metabolic Disease
Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .

HY-P1298

Sauvagine	CRFR	Cardiovascular Disease Neurological Disease Endocrinology
Sauvagine, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine is effective at releasing ACTH from rat pituitary cells. Sauvagine possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .

HY-P1293

Conantokin G	iGluR	Neurological Disease
Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G inhibits NMDA-evoked currents in murine cortical neurons with an IC₅₀ of 480 nM. Conantokin G has neuroprotective properties .

HY-P1298A

Sauvagine TFA	CRFR	Cardiovascular Disease Neurological Disease Endocrinology
Sauvagine TFA, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine TFA is effective at releasing ACTH from rat pituitary cells. Sauvagine TFA possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .

HY-P1293A

Conantokin G TFA	iGluR	Neurological Disease
Conantokin G TFA, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G TFA inhibits NMDA-evoked currents in murine cortical neurons with an IC₅₀ of 480 nM. Conantokin G TFA has neuroprotective properties .

HY-105037

Forigerimod IPP-201101	Autophagy	Inflammation/Immunology
Forigerimod (IPP-201101) is a CD4 T-cell modulator. Forigerimod is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod can potently inhibit autophagy. Forigerimod can be used for the research of autoimmune disorders, such as systemic lupus erythematosus (SLE) .

HY-P1525

Melanin Concentrating Hormone, salmon MCH (salmon)	MCHR1 (GPR24)	Cardiovascular Disease Neurological Disease Metabolic Disease Endocrinology
Melanin Concentrating Hormone, salmon is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.

HY-P2230

Angstrom6 A6 Peptide	PAI-1	Cancer
Angstrom6 (A6 Peptide) is an 8 amino-acid peptide derived from single-chain urokinase plasminogen activator (scuPA) and interferes with the uPA/uPAR cascade and abrogates downstream effects. Angstrom6 binds to CD44 resulting in the inhibition of migration, invasion, and metastasis of tumor cells, and the modulation of CD44-mediated cell signaling .

HY-P1674A

Murepavadin TFA 2 Publications Verification POL7080 TFA	Bacterial Antibiotic	Infection
Murepavadin (POL7080) (TFA), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with MIC₅₀ and MIC₉₀ values both of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .

HY-P1674

Murepavadin POL7080	Bacterial Antibiotic	Infection
Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC₅₀ and MIC₉₀ values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .

HY-P10876

mcK6A1	Amyloid-β	Neurological Disease
mcK6A1 is an inhibitor for the aggregation of amyloid-β (Aβ), that selectively binds to the 16KLVFFA21 segment of Aβ42, forms an extended β-folded structure, and inhibits the formation of Aβ42 oligomers. mcK6A1 can be used in research of Alzheimer's disease and other amyloid-related diseases .

HY-P1525A

Melanin Concentrating Hormone, salmon TFA MCH (salmon) (TFA)	MCHR1 (GPR24)	Cardiovascular Disease Neurological Disease Metabolic Disease Endocrinology
Melanin Concentrating Hormone, salmon TFA (MCH (salmon) TFA) is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.

HY-105037A

Forigerimod TFA IPP-201101 TFA	Autophagy	Inflammation/Immunology
Forigerimod TFA (IPP-201101 TFA) is a CD4 T-cell modulator. Forigerimod TFA is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod TFA can potently inhibit autophagy. Forigerimod can be used for the research of autoimmune disorders, such as systemic lupus erythematosus (SLE) .

HY-P10341

ZP3022	GCGR	Metabolic Disease
ZP3022 is a dual agonist of glucagon-like peptide-1 (GLP-1) and gastrin that has the ability to sustainably improve glycemic control. Additionally, ZP3022 can effectively increase β-cell mass, promote β-cell proliferation, and enhance the function of pancreatic islets. ZP3022 can be used in anti-diabetic research .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P3906

Melittin free acid	Fungal Apoptosis Phospholipase Reactive Oxygen Species (ROS)	Infection
Melittin free acid is a basic 26-amino-acid polypeptide, the major active ingredient of honeybee venom. Melittin free acid is an activator of phospholipase A2 (PLA2). Melittin free acid has broad-spectrum antifungal activity with MIC values of 0.4-60 μM. Melittin free acid hinders fungal growth by inducing cell apoptosis, repressing (1,3)-β-D-glucan synthase and participating in other pathways .

HY-P4146

Survodutide BI 456906	GLP Receptor GCGR	Metabolic Disease
Survodutide (BI 456906) is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC₅₀s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P10218A

MANS peptide TFA	MARCKS PKC	Inflammation/Immunology Cancer
MANS peptide TFA is the TFA salt form of MANS peptide (HY-P10218). MANS peptide TFA is an inhibitor for myristoylated alanine-rich C kinase substrate (MARCKS), which competes with MARCKS in cells for membrane binding, and thus inhibits the stimulation of mucin secretion and tumor metastasis .

HY-P10218

MANS peptide	MARCKS PKC	Inflammation/Immunology Cancer
MANS peptide is an inhibitor for myristoylated alanine-rich C kinase substrate (MARCKS), which competes with MARCKS in cells for membrane binding, and thus inhibits the stimulation of mucin secretion and tumor metastasis .

HY-P4146A

Survodutide TFA BI 456906 TFA	GLP Receptor GCGR	Metabolic Disease
Survodutide (BI 456906) TFA is a potent, selective glucagon receptor/GLP-1 receptor (GCGR/GLP-1R) dual agonist with EC₅₀s of 0.52 nM and 0.33 nM in CHO-K1 cells, respectively. Survodutide TFA, a 29-amino-acid peptide, is a potent acylated peptide containing a C18 fatty acid. Survodutide TFA has robust anti-obesity efficacy achieved by increasing energy expenditure and decreasing food intake .

HY-169089

RP-182-PEG3-K(palmitic acid)	Drug Derivative	Cancer
RP-182-PEG3-K palmitic acid (Compound 1a) is a fatty acid derivative of the immunomodulatory peptide RP-182. RP-182-PEG3-K palmitic acid inhibits CD206 ^high M2-like macrophage (IC₅₀ of 3.2 μM) and induces phagocytosis. RP-182-PEG3-K palmitic acid exhibits antitumor efficacy in mouse B16 melanoma allografts .

HY-P10318

SHR-2042	GLP Receptor	Endocrinology
SHR-2042 is a selective agonist of the GLP-1 receptor.SHR-2042 improves glycemic control by activating the GLP-1 receptor, enhancing insulin secretion and inhibiting glucagon secretion. SHR-2042 combined with sodium N-(8-[2-hydroxybenzoyl] amino) caprylate (SNAC) promotes monomerization through the formation of micelles and improves oral absorption efficiency .

HY-P2231

Cotadutide 1 Publications Verification MEDI0382	GCGR	Metabolic Disease
Cotadutide (MEDI0382) is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC₅₀ values of 6.9 pM and 10.2 pM, respectively. Cotadutide exhibits ability to facilitate both weight loss and glycaemic control, and alleviate fibrosis. Cotadutide can be used in the research of obesity and type 2 diabetes (T2D) .

HY-P2231A

Cotadutide acetate 1 Publications Verification MEDI0382 acetate	GCGR	Metabolic Disease
Cotadutide (MEDI0382) acetate is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC₅₀ values of 6.9 pM and 10.2 pM, respectively. Cotadutide acetate exhibits ability to facilitate both weight loss and glycaemic control, and alleviate fibrosis. Cotadutide acetate can be used in the research of obesity and type 2 diabetes (T2D) .

HY-P0014A

Liraglutide acetate	GLP Receptor	Metabolic Disease
Liraglutide acetate is the acetate form of Liraglutide (HY-P0014), a glucagon-like peptide-1 (GLP-1) receptor agonist studied in type 2 diabetes .

Cat. No.	Product Name	Type

HY-W010991

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly

FAPGG

Chromogenic Substrates Amino acids and Derivatives

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a specific substrate of angiotensin converting enzyme (ACE) with a Ki of 2.546×10 ^-4 M. It is used as a chromogenic probe for quantitative detection of ACE activity. N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly can be hydrolyzed by ACE to generate N-[3-(2-furyl)acryloyl]-Phe (FAP) and Gly-Gly, and the ACE inhibitory effect is monitored by photometry. FAPGG competitively binds to the active center of ACE and is a key tool for screening ACE inhibitors such as Captopril (HY-B0368) and Dioscorin. Its reversible mechanism of action supports hypertension research and drug development targeting the renin-angiotensin system .

HY-W142117

H-Asp(AMC)-OH	Amino acids and Derivatives Fluorescent Dyes/Probes
H-Asp(AMC)-OH, a amino acid derivative, is a fluorescent dye. H-Asp(AMC)-OH dose not inhibit glycine transport at a concentration of 0.25 mM .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-P0173A

Chlorotoxin 1 Publications Verification	Structural Classification Natural Products Animals Classification of Application Fields Source classification Disease Research Fields Cancer	Chloride Channel
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.

HY-P0285

Rabies Virus Glycoprotein 1 Publications Verification	Infection Structural Classification Natural Products Microorganisms Classification of Application Fields Source classification Disease Research Fields	RABV
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.

HY-W040705

2-(Methylamino)benzoic acid N-Methylanthranilic acid	Structural Classification Ketones, Aldehydes, Acids Source classification Endogenous metabolite	Drug Metabolite
2-(Methylamino)benzoic acid is the main metabolite of methyl-N-methylanthranilates (MMA) (HY-76705) and is the compound in which the ester group is converted. MMA can be isolated from citrus fruits and has potential analgesic activity. 2-(Methylamino)benzoic acid was used to detect the metabolic levels of MMA in rat liver .

HY-W015465

N-Acetyl-D-valine	Microorganisms Source classification	Amino Acid Derivatives
N-Acetyl-D-valine is a valine derivative .

HY-113119

N-Butyrylglycine	Source classification	Amino Acid Derivatives
N-Butyrylglycine is a Glycine (HY-Y0966) derivative .

HY-N5191

Epidermin	Structural Classification Microorganisms Antibiotics Source classification Other Antibiotics	Antibiotic Bacterial
Epidermin is a type A lantibiotic that is a tetracyclic 21-amino-acid peptide. Epidermin exhibits antibiotic activity against many Gram-positive bacteria. Epidermin has a role as a metabolite and an antibacterial agent .

HY-P1293

Conantokin G	Structural Classification Natural Products Animals Source classification	iGluR
Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G inhibits NMDA-evoked currents in murine cortical neurons with an IC₅₀ of 480 nM. Conantokin G has neuroprotective properties .

HY-P1293A

Conantokin G TFA	Natural Products Animals Source classification	iGluR
Conantokin G TFA, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G TFA inhibits NMDA-evoked currents in murine cortical neurons with an IC₅₀ of 480 nM. Conantokin G TFA has neuroprotective properties .

HY-W065053

trans-N-Methyl-4-methoxyproline	Natural Products Source classification Allium sativum L. Plants Amaryllidaceae	Amino Acid Derivatives
trans-N-Methyl-4-methoxyproline is a natural product that can be isolated from the stems of Petiveria alliacea and is also a Proline derivative .

HY-W587803R

Propionylglycine (Standard)	Microorganisms Source classification	Others Reference Standards
Ergosterol (Standard) is the analytical standard of Ergosterol. This product is intended for research and analytical applications. Ergosterol is the primary sterol found in fungi, with antioxidative, anti-proliferative, and anti-inflammatory effects.

HY-126169

L-Glutamine amide	Infection Structural Classification Natural Products Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields	Endogenous Metabolite
L-Glutamine amide is a metabolite involved in glutamate metabolism.

HY-30216AR

Leucic acid (Standard) α-Hydroxyisocaproic acid (Standard)	Structural Classification Ketones, Aldehydes, Acids Source classification Endogenous metabolite	Endogenous Metabolite Reference Standards
Leucic acid (Standard) is the analytical standard of Leucic acid. This product is intended for research and analytical applications. Leucic acid is an amino acid metabolite .

HY-107848

DL-O-Tyrosine NSC 72345; Ortho-tyrosine; o-DL-Tyrosine; o-Tyrosine	Structural Classification Classification of Application Fields Ketones, Aldehydes, Acids Source classification Other Diseases Endogenous metabolite Disease Research Fields	Amino Acid Derivatives
DL-O-Tyrosine is a tyrosine derivative .

HY-121520

Docosahexaenoyl glycine	Cardiovascular Disease Structural Classification Alkaloids Classification of Application Fields Ketones, Aldehydes, Acids Other Alkaloids Source classification Endogenous metabolite Disease Research Fields	Potassium Channel Endogenous Metabolite
Docosahexaenoyl glycine is a PUFA analogue. Docosahexaenoyl glycine has activating effects on IKs channels and restore the function of IKs channels with LQT1 mutation .

HY-113084

L-Cysteine S-sulfate	Structural Classification Natural Products Immune System Disorder Neurological Disease Classification of Application Fields Disease markers Endocrine diseases Nervous System Disorder Endogenous metabolite Disease Research Fields	iGluR Endogenous Metabolite
L-Cysteine S-sulfate is a potent N-methyl-d-aspartate (NMDA) glutamatergic receptor agonist. L-Cysteine S-sulfate is the substrate for cystine lyase, and can be used in mass spectrometry operations .

HY-20897A

5-Bromo-L-tryptophan 1 Publications Verification	Structural Classification Natural Products Classification of Application Fields Source classification Other Diseases Endogenous metabolite Disease Research Fields	Endogenous Metabolite
5-Bromo-L-tryptophan is an α-amino acid derivative that can be found in Semenospongia sp. .

HY-Y1091

D-Lysine	Structural Classification Classification of Application Fields Source classification Other Diseases Amino acids Endogenous metabolite Disease Research Fields	Endogenous Metabolite
D-Lysine is a useful raw material employed as an analog of lutenizing-hormone-releasing hormone and as a agent carrier in the form of polylysine. D-Lysine decreases renal uptake of radioactivity during scintigraphy and PRRT with low toxicity. D-Lysine not interferes with the natural amino acid metabolic balance .

HY-W015424

N-Methyl-DL-glutamic acid 1 Publications Verification	Structural Classification Natural Products Classification of Application Fields Source classification Other Diseases Endogenous metabolite Disease Research Fields	Endogenous Metabolite
N-Methyl-DL-glutamic acid is a L-Glutamic acid (HY-14608) analog with cytotoxic effects .

HY-N7831

N-Oleoyl alanine OlAla	Structural Classification Ketones, Aldehydes, Acids Gramineae Source classification Hordeum vulgare Plants	Amino Acid Derivatives
N-Oleoyl alanine (OlAla) is aalanine derivatives.

HY-Y1080

N-Acetyl-R-leucine N-Acetyl-D-leucine	Microorganisms Source classification	Amino Acid Derivatives Monocarboxylate Transporter
N-Acetyl-R-leucine is an amino-protecting group N-substituted chiral amino acid. N-Acetyl-R-leucine is a PepT1 and MCT1 inhibitor with IC₅₀ of 0.74 and 11 mM, respectively. N-Acetyl-R-leucine can be used for LysoTracker signaling studies .

HY-121705

Propionyl-L-carnitine	Structural Classification Natural Products Classification of Application Fields Source classification Endogenous metabolite Inflammation/Immunology Disease Research Fields	Endogenous Metabolite Apoptosis Bcl-2 Family NF-κB Survivin Src Akt AMPK NO Synthase
Propionyl-L-carnitine is an orally active L-carnitine derivative. Propionyl-L-carnitine has a high affinity for muscle L-carnitine transferase. Propionyl-L-carnitine increases Apoptosis, Bax, and reduces NF-κB, VCAM-1, MCP-1, and survivin. Propionyl-L-carnitine activates Src kinase, Akt, induces p-AMPK and nitric oxide synthesis. Propionyl-L-carnitine alleviates cardiovascular disease, obesity, and colitis .

HY-W015450

D-Ala-D-Ala	Structural Classification Natural Products Human Gut Microbiota Metabolites Classification of Application Fields Source classification Other Diseases Endogenous metabolite Disease Research Fields	Endogenous Metabolite
D-Ala-D-Ala is a bacterial endogenous metabolite. D-Ala-D-Ala constitutes the terminus of the peptide part of the peptidoglycan monomer unit and is involved in the transpeptidation reaction as the substrate. D-Ala-D-Ala is catalyzed by D-Alanine-D-Alanine ligase .

HY-30216A

Leucic acid α-Hydroxyisocaproic acid	Structural Classification Classification of Application Fields Ketones, Aldehydes, Acids Source classification Other Diseases Endogenous metabolite Disease Research Fields	Endogenous Metabolite
Leucic acid is an amino acid metabolite .

HY-W587803

Propionylglycine	Microorganisms Source classification	Others
Propionylglycine is a peptide .

HY-113214R

3,5-Diiodo-L-tyrosine (Standard)	Microorganisms Source classification	Amino Acid Derivatives Reference Standards
3,5-Diiodo-L-tyrosine (Standard) is the analytical standard of 3,5-Diiodo-L-tyrosine. This product is intended for research and analytical applications. 3,5-Diiodo-L-tyrosine is a tyrosine derivative .

HY-W141810

*4-Amino-L-phenylalanine hydrochloride* H-Phe(4-NH2)-OH hydrochloride	Structural Classification Natural Products Classification of Application Fields Source classification Other Diseases Endogenous metabolite Disease Research Fields	Endogenous Metabolite
4-Amino-L-phenylalanine (H-Phe(4-NH2)-OH) hydrochloride is an endogenous metabolite.

HY-20897AR

5-Bromo-L-tryptophan (Standard)	Structural Classification Natural Products Source classification Endogenous metabolite	Endogenous Metabolite
5-Bromo-L-tryptophan (Standard) is the analytical standard of 5-Bromo-L-tryptophan. This product is intended for research and analytical applications. 5-Bromo-L-tryptophan is an α-amino acid derivative that can be found in Semenospongia sp. .

HY-W005388

(S)-2-(Methylamino)-3-phenylpropanoic acid	Structural Classification Natural Products Microorganisms Classification of Application Fields Source classification Other Diseases Disease Research Fields	Amino Acid Derivatives
(S)-2-(Methylamino)-3-phenylpropanoic acid is a phenylalanine derivative .

HY-113064

Selenocystine 1 Publications Verification	Structural Classification Natural Products Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields Cancer	Endogenous Metabolite
Selenocystine is a broad-spectrum anti-cancer agent. Selenocystine induces DNA damage in HepG2 cells, particularly in the form of DNA double strand breaks (DSBs). Selenocystine exhibits great promise as a therapeutic or adjuvant agent targeting DNA repair for cancer treatment .

HY-137851

S-Pyruvylglutathione	Human Gut Microbiota Metabolites Source classification Endogenous metabolite	Drug Metabolite
S-Pyruvylglutathione is a serum metabolite and can be used as a potential marker for sensitivity of gastric cancer to neoadjuvant chemotherapy .

HY-W015450R

D-Ala-D-Ala (Standard)	Structural Classification Natural Products Human Gut Microbiota Metabolites Source classification Endogenous metabolite	Reference Standards Endogenous Metabolite
D-Ala-D-Ala (Standard) is the analytical standard of D-Ala-D-Ala. This product is intended for research and analytical applications. D-Ala-D-Ala is a bacterial endogenous metabolite. D-Ala-D-Ala constitutes the terminus of the peptide part of the peptidoglycan monomer unit and is involved in the transpeptidation reaction as the substrate. D-Ala-D-Ala is catalyzed by D-Alanine-D-Alanine ligase .

HY-W013293R

Boc-D-Tyr-OH (Standard)	Structural Classification Natural Products Leguminosae Source classification Vigna radiata (L.) Wilczek Plants	Amino Acid Derivatives Reference Standards
Boc-D-Tyr-OH (Standard) is the analytical standard of Boc-D-Tyr-OH. This product is intended for research and analytical applications. Boc-D-Tyr-OH is a tyrosine derivative .

HY-W040705R

2-(Methylamino)benzoic acid (Standard) N-Methylanthranilic acid (Standard)	Structural Classification Ketones, Aldehydes, Acids Source classification Endogenous metabolite	Drug Metabolite Reference Standards
2-(Methylamino)benzoic acid (Standard) is the analytical standard of 2-(Methylamino)benzoic acid. This product is intended for research and analytical applications. 2-(Methylamino)benzoic acid is the main metabolite of methyl-N-methylanthranilates (MMA) (HY-76705) and is the compound in which the ester group is converted. MMA can be isolated from citrus fruits and has potential analgesic activity. 2-(Methylamino)benzoic acid was used to detect the metabolic levels of MMA in rat liver[1].

HY-119543

O-Succinyl-L-homoserine	Human Gut Microbiota Metabolites Microorganisms Source classification Endogenous metabolite	Amino Acid Derivatives
O-Succinyl-L-homoserine is a homoserine derivative. O-Succinyl-L-homoserine is an intermediate in the biosynthesis of methionine in Escherichia coli and Salmonella typhimurium .

HY-W004114

N-Acetyl-L-proline	Structural Classification Alkaloids Pyrrole Alkaloids Classification of Application Fields Source classification Other Diseases Endogenous metabolite Disease Research Fields	Amino Acid Derivatives Endogenous Metabolite
N-Acetyl-L-proline is aproline derivatives.

HY-W013293

Boc-D-Tyr-OH	Structural Classification Natural Products Classification of Application Fields Leguminosae Source classification Other Diseases Vigna radiata (L.) Wilczek Plants Disease Research Fields	Amino Acid Derivatives
Boc-D-Tyr-OH is a tyrosine derivative .

HY-W012497

N-Acetyl-D-methionine	Microorganisms Source classification	Amino Acid Derivatives
N-Acetyl-D-methionine is a Methionine (HY-13694) derivative .

HY-W009203

L-Cystine dihydrochloride 2 Publications Verification	Classification of Application Fields Ketones, Aldehydes, Acids Source classification Other Diseases Endogenous metabolite Disease Research Fields	Endogenous Metabolite Apoptosis Keap1-Nrf2 Reactive Oxygen Species (ROS) Ferroptosis
L-Cystine dihydrochloride is the dihydrochloride salt form of L-Cystine (HY-N0394). L-Cystine dihydrochloride elevates Nrf2 protein expression and activates Nrf2 transcription factor. L-cystine dihydrochloride reduces ROS generation and protects against oxidant- or Doxorubicin (HY-15142A)-induced apoptosis. L-Cystine dihydrochloride combined with L-theanine (HY-15121) enhances the production of antigen-specific IgG by increasing glutathione (GSH) levels and T helper 2 (Th2) mediated responses in mice. L-Cystine dihydrochloride is promising for research of cystinuria and kidney stones

HY-105055

Didemnin B	Structural Classification Natural Products Animals Classification of Application Fields Marine natural products Source classification Other marine organisms Disease Research Fields Cancer	Others
Didemnin B is a depsipeptide extracted from the marine tunicate Trididemnin cyanophorum. Didemnin B can be used for the research of cancer .

Cat. No.	Product Name	Chemical Structure

HY-P0014S2

Liraglutide-13C6,15N TFA
Liraglutide- ¹³C₆, ¹⁵N (TFA)is the ¹³C and ¹⁵N labeledLiraglutide(HY-P0014). Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus .

HY-P0014S1

Liraglutide-13C5,15N TFA
Liraglutide- ¹³C₅, ¹⁵N (tetraTFA) is the ¹³C and ¹⁵N labeled Liraglutide (HY-P0014) . Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus .

HY-P0014AS

Liraglutide-d8 tetraTFA
Liraglutide-d₈ tetraTFA is deuterium labeled Liraglutide (HY-P0014). Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used for the study of type 2 diabetes mellitus .

Cat. No.	Compare	Product Name	Application	Reactivity

HY-P82620

	EAAT3 Antibody (YA2365) SLC1A1; EAAC1; EAAT3; Excitatory amino acid transporter 3; Excitatory amino-acid carrier 1; Neuronal and epithelial glutamate transporter; Sodium-dependent glutamate/aspartate transporter 3; Solute carrier family 1 member 1	WB, IHC-P, ICC/IF	Human, Mouse, Rat
	EAAT3 Antibody (YA2365) is a rabbit-derived non-conjugated IgG antibody (Clone NO.: YA2365), targeting EAAT3, with a predicted molecular weight of 57 kDa (observed band size: 70 kDa). EAAT3 Antibody (YA2365) can be used for WB, IHC-P, ICC/IF experiment in human, mouse, rat background.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Host
Reactivity
Application
Dilution Ratio
Molecular Weight
Conjugation
Clonality
Immunogen
Appearance
Isotype
Gene ID
SwissProt ID
Purity
Formulation
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Product Name		Classification

HY-W014258

*(R)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid*		Alkynes
(R)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a Glycine (HY-Y0966) derivative . (R)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-W008395

Fmoc-D-Pra-OH		Alkynes
Fmoc-D-Pra-OH is a Glycine (HY-Y0966) derivative . Fmoc-D-Pra-OH is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-W011210

Fmoc-Pra-OH		Alkynes
Fmoc-Pra-OH is a Glycine (HY-Y0966) derivative . Fmoc-Pra-OH is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-W014259

*(S)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid*		Alkynes
(S)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a Glycine (HY-Y0966) derivative . (S)-2-((tert-Butoxycarbonyl)amino)pent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-W048205

N6-Diazo-L-Fmoc-lysine		Azide
N6-Diazo-L-Fmoc-lysine is an active compand and can be used in a variety of chemical studies. N6-Diazo-L-Fmoc-lysine is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.

HY-W006064

(S)-2-Aminopent-4-ynoic acid		Alkynes
(S)-2-Aminopent-4-ynoic acid is a synthetic amino acid. (S)-2-Aminopent-4-ynoic acid can be used in synthesis of folate-conjugates and corresponding metal-chelate complexes . (S)-2-Aminopent-4-ynoic acid is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-W142062

cis-Fmoc-Pro(4-N3)-OH Fmoc-(2S,4S)-4-azidoproline		Azide
cis-Fmoc-Pro(4-N3)-OH is a proline derivative . cis-Fmoc-Pro(4-N3)-OH is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.

HY-W040124

DL-Propargylglycine		Alkynes
DL-Propargylglycine is a Glycine (HY-Y0966) derivative . DL-Propargylglycine is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-151641

3-Azido-L-alanine		Azide
3-Azido-L-alanine is an aliphatic functionalized amino acid with side chain lengths of up to four carbons . 3-Azido-L-alanine is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社重松貿易株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks