2. Search Result
Search Result
Results for "

adjuvant arthritis

" in MedChemExpress (MCE) Product Catalog:

34

Inhibitors & Agonists

2

Peptides

3

Natural
Products

2

Isotope-Labeled Compounds

3

Oligonucleotides

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-107634
    CP-20961

    Avridine

    		 IFNAR Infection Inflammation/Immunology
    CP-20961 is an interferon inducer. CP-20961 is a potent synthetic non-immunogenic adjuvant that induces arthritis .
    CP-20961
  • HY-153808B
    Complete Freund's adjuvant (CFA, 1 mg/ml)

    		Toll-like Receptor (TLR) Inflammation/Immunology
    Complete Freund's adjuvant (CFA, 1 mg/ml) is an immunoadjuvant emulsified with antigen that can enhance an animal's immune response to an antigen. Complete Freund's adjuvant (CFA, 1 mg/ml) is also an inducer of the Th1 immune response and a ligand of TLRs. Complete Freund's adjuvant (CFA, 1 mg/ml) contains heat-killed inactive tuberculosis bacilli and consists of a paraffin oil-in-water emulsion. Complete Freund's adjuvant (CFA, 1 mg/ml) stimulates a strong and durable immune response and can be used to induce rheumatoid arthritis in rats, and more .
    Complete Freund's adjuvant (CFA, 1 mg/ml)
  • HY-142123
    Fluocortolone

    		Glucocorticoid Receptor Inflammation/Immunology
    Fluocortolone is an orally active anti-inflammatory agent that effectively reduces plasma fibrinogen levels. Fluocortolone inhibits Mycobacterium butyricum-induced foot edema in a rat model of adjuvanted joint inflammation (3-12 mg/kg) .
    Fluocortolone
  • HY-167676
    Cofpropamine

    		DNA/RNA Synthesis Inflammation/Immunology
    Cofpropamine, a caffeine derivative that inhibits polyadenylation, enhances the inhibitory effect of cyclophosphamide (HY-17420) in rat adjuvant arthritis and mouse collagen arthritis models .
    Cofpropamine
  • HY-106027
    Romazarit

    RO 31-3948

    		 PPAR Metabolic Disease Inflammation/Immunology
    Romazarit (RO 31-3948) is an anti-inflammatory agent with antirheumatic effect. Romazarit exhibits PPARα agonist activity. Romazarit (30 mg/kg) inhibits the development of hindpaw inflammation in an adjuvant arthritis model .
    Romazarit
  • HY-116230
    BI-L-45 XX

    		Ser/Thr Protease Inflammation/Immunology
    BI-L-45 XX is an orally active anti-inflammatory agent. BI-L-45 XX can inhibit the release of neutrophil enzymes and chemotaxis, and is used in the study of adjuvant-induced arthritis .
    BI-L-45 XX
  • HY-120049
    TAK-603

    		Interleukin Related IFNAR Inflammation/Immunology
    TAK-603 is a potent and orally active antirheumatic agent. TAK-603 inhibits Thl-type cytokine production. TAK-603 has the potential for the research of adjuvant arthritis .
    TAK-603
  • HY-114897
    L-167307

    		p38 MAPK Inflammation/Immunology
    L-167307 is an effective pyrrole-based p38 kinase inhibitor that can reduce secondary paw swelling in rat adjuvant-induced arthritis models .
    L-167307
  • HY-114565
    LY221068

    		Lipoxygenase Enterovirus Inflammation/Immunology
    LY221068 is an anti-oxidant and an orally active, potent inhibitor of iron-dependent lipid peroxidation and 5-lipoxygenase with antiinflammatory properties. LY221068 inhibits bone damage and paw swelling in the Freund's Complete adjuvant (HY-153808) induced arthritis (FCA) model of rats. LY221068 is promising for research of arthritis .
    LY221068
  • HY-142123R
    Fluocortolone (Standard)

    		Glucocorticoid Receptor Reference Standards Inflammation/Immunology
    Fluocortolone (Standard) is the analytical standard of Fluocortolone. This product is intended for research and analytical applications. Fluocortolone is an orally active anti-inflammatory agent that effectively reduces plasma fibrinogen levels. Fluocortolone inhibits Mycobacterium butyricum-induced foot edema in a rat model of adjuvanted joint inflammation (3-12 mg/kg) .
    Fluocortolone (Standard)
  • HY-N2843
    α-Amyrin palmitate

    		Others Inflammation/Immunology
    α-Amyrin palmitate is isolated from Santalum album (sandalwood). α-Amyrin palmitate can be used for the study of arthritis in vivo .
    α-Amyrin palmitate
  • HY-P4191
    Met-RANTES (human)

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    		 CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-119530
    Thiamiprine

    BW 57-323

    		 Nucleoside Antimetabolite/Analog Others
    Thiamiprine (BW 57-323) is a compound related to azathioprine. Its nucleoside forms are similar to the parent compound in terms of cytotoxicity in vitro (except for the arabinoside). In the rat adjuvant arthritis model in vivo, its riboside and 2'-deoxyriboside are less active than the parent compound. The arabinoside is inactive and nontoxic. It has similar potency to the other parent compounds tested, but has a different safety profile.
    Thiamiprine
  • HY-W050088
    Isoxepac

    HP 549

    		 Drug Derivative Neurological Disease Inflammation/Immunology
    Isoxepac (HP 549) is an orally active non-steroidal anti-inflammatory agent. Isoxepac can inhibit Carrageenan (HY-125474) paw oedema, adjuvant-induced polyarthritis, and prostaglandin synthesis. Isoxepac (200 mg) has an analgesic effect after meniscectomy with a low incidence of side effects. Isoxepac can be used in the research of inflammatory (rheumatoid arthritis) and pain-related diseases .
    Isoxepac
  • HY-P4191A
    Met-RANTES (human) (acetate)

    		CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) (acetate)
  • HY-14305
    BMS-582949

    		p38 MAPK Inflammation/Immunology
    BMS-582949 (compound 7k) is an orally active and highly selective p38α MAP kinase inhibitor, with IC50 values of 13 nM for p38α, and 50 nM for cellular TNFα. BMS-582949 can be used for research on rheumatoid arthritis .
    BMS-582949
  • HY-N0807
    Swertiamarin

    		MMP NF-κB JAK Keap1-Nrf2 Metabolic Disease Inflammation/Immunology Cancer
    Swertiamarin is an orally active natural product with hypoglycemic, lipid-lowering, anti-rheumatic, and antioxidant activities. Swertiamarin can regulate the levels of pro-inflammatory cytokines, MMP, and NF-κB, and promote osteoblast proliferation. Swertiamarin has antioxidant and hepatoprotective effects against carbon tetrachloride induced rat liver toxicity through the Nrf2/HO-1 pathway. Swertiamarin can attenuate inflammatory mediators by regulating JAK2/STAT3 transcription factors in adjuvant induced arthritis rats. Swertiamarin can be used in the research of diabetes and arthritis .
    Swertiamarin
  • HY-167715
    Traxanox

    		Histamine Receptor Phosphodiesterase (PDE) Inflammation/Immunology
    Traxanox is an orally available diuretic that enhances phagocytosis of yeast granules by mouse peritoneal macrophages and rat peritoneal polymorphonuclear leukocytes in vitro. Traxanox inhibits IgE-mediated histamine release and cyclic AMP phosphodiesterase activity.Traxanox exhibits anti-inflammatory activity, as it inhibits the anaphylactoid reaction and reduces pleural fluid accumulation in experimental models of inflammation. Traxanox also demonstrates a synergistic effect when combined with hydrocortisone or indomethacin in suppressing adjuvant arthritis in rats.
    Traxanox
  • HY-119821R
    Terphenyllin (Standard)

    		Reference Standards Glycosidase Infection
    Thiamiprine (Standard) is the analytical standard of Thiamiprine. This product is intended for research and analytical applications. Thiamiprine (BW 57-323) is a compound related to azathioprine. Its nucleoside forms are similar to the parent compound in terms of cytotoxicity in vitro (except for the arabinoside). In the rat adjuvant arthritis model in vivo, its riboside and 2'-deoxyriboside are less active than the parent compound. The arabinoside is inactive and nontoxic. It has similar potency to the other parent compounds tested, but has a different safety profile.
    Terphenyllin (Standard)
  • HY-114873
    LY256548

    LY25684

    		 Phospholipase COX Lipoxygenase Leukotriene Receptor Inflammation/Immunology
    LY256548 (LY25648) is an orally available anti-ischemic and anti-inflammatory compound with central nervous system activity. LY256548 is an inhibitor of phospholipase A2, 5-lipoxygenase (5-LOX), and COX, and inhibits A23187 (HY-N6687)-stimulated leukotriene B4 production. LY256548 inhibits bone damage and paw swelling in the rat Freund's complete adjuvant-induced arthritis (FCA) model .
    LY256548
  • HY-119530R
    Thiamiprine (Standard)

    BW 57-323 (Standard)

    		 Nucleoside Antimetabolite/Analog Reference Standards Others
    Thiamiprine (Standard) is the analytical standard of Thiamiprine. This product is intended for research and analytical applications. Thiamiprine (BW 57-323) is a compound related to azathioprine. Its nucleoside forms are similar to the parent compound in terms of cytotoxicity in vitro (except for the arabinoside). In the rat adjuvant arthritis model in vivo, its riboside and 2'-deoxyriboside are less active than the parent compound. The arabinoside is inactive and nontoxic. It has similar potency to the other parent compounds tested, but has a different safety profile.
    Thiamiprine (Standard)
  • HY-121856
    Flumizole

    		Others Inflammation/Immunology
    Flumizole, a derivative of substituted 5,6-diaryl-2,3-dihydroimidazo[2,1-b]thiazoles, was synthesized and evaluated for its immunoregulatory and anti-inflammatory properties in animal models such as rat adjuvant-induced arthritis and mouse oxazolone-induced contact sensitivity assays. This compound class combines structural elements from flumizole and levamisole, aiming to enhance therapeutic efficacy. Symmetrically substituted 5,6-diaryl compounds with specific alkyl heteroatom or halogen substitutions showed optimal potency in the arthritis model. However, variations in activity were less consistent in the contact sensitivity assay. Flumizole and related compounds demonstrate potential as dual-action agents, targeting inflammation and immune modulation, offering promise for therapeutic development in immune-related disorders .
    Flumizole
  • HY-111164
    CBS-3595

    		p38 MAPK Phosphodiesterase (PDE) Inflammation/Immunology
    CBS-3595 is a dual inhibitor of p38 MAP kinase and phosphodiesterase 4 with anti-inflammatory and anti-allodynic activities. CBS-3595 reduces the production of the proinflammatory cytokine IL-6 and increases the levels of the anti-inflammatory cytokine IL-10 in rats. CBS-3595 reduces paw oedema formation in the Complete Freund’s adjuvant (CFA) (HY-153808)-induced arthritis rat model. CBS-3595 is promising for research of autoimmune diseases .
    CBS-3595
  • HY-W050088S
    Isoxepac-d6

    HP 549-d6

    		 Isotope-Labeled Compounds Drug Derivative Neurological Disease Inflammation/Immunology
    Isoxepac-d6 (HP 549-d6) is the deuterium labeled Isoxepac (HY-W050088). Isoxepac (HP 549) is an orally active non-steroidal anti-inflammatory agent. Isoxepac can inhibit Carrageenan (HY-125474) paw oedema, adjuvant-induced polyarthritis, and prostaglandin synthesis. Isoxepac (200 mg) has an analgesic effect after meniscectomy with a low incidence of side effects. Isoxepac can be used in the research of inflammatory (rheumatoid arthritis) and pain-related diseases .
    Isoxepac-d6
  • HY-B1138
    Fenbufen
    1 Publications Verification

    CL-82204

    		 COX Caspase Inflammation/Immunology
    Fenbufen (CL-82204) is an orally active non-steroidal anti-inflammatory drug (NSAID), with analgetic and antipyretic effects. Fenbufen has potent activity in a variety of animal model, including carageenin edema, UV erythema and adjuvant arthritis. Fenbufen has inhibitory activities against COX-1 and COX-2 with IC50s of 3.9 μM and 8.1 μM, respectively. Fenbufen is a caspases (caspase-1, 3, 4, 5, 9) inhibitor .
    Fenbufen
  • HY-W050088R
    Isoxepac (Standard)

    HP 549 (Standard)

    		 Reference Standards Drug Derivative Neurological Disease Inflammation/Immunology
    Isoxepac (Standard) (HP 549 (Standard)) is the analytical standard of Isoxepac (HY-W050088). This product is intended for research and analytical applications. Isoxepac (HP 549) is an orally active non-steroidal anti-inflammatory agent. Isoxepac can inhibit Carrageenan (HY-125474) paw oedema, adjuvant-induced polyarthritis, and prostaglandin synthesis. Isoxepac (200 mg) has an analgesic effect after meniscectomy with a low incidence of side effects. Isoxepac can be used in the research of inflammatory (rheumatoid arthritis) and pain-related diseases .
    Isoxepac (Standard)
  • HY-B1138R
    Fenbufen (Standard)

    CL-82204 (Standard)

    		 Reference Standards COX Caspase Inflammation/Immunology
    Fenbufen (Standard) is the analytical standard of Fenbufen. This product is intended for research and analytical applications. Fenbufen (CL-82204) is an orally active non-steroidal anti-inflammatory drug (NSAID), with analgetic and antipyretic effects. Fenbufen has potent activity in a variety of animal model, including carageenin edema, UV erythema and adjuvant arthritis. Fenbufen has inhibitory activities against COX-1 and COX-2 with IC50s of 3.9 μM and 8.1 μM, respectively. Fenbufen is a caspases (caspase-1, 3, 4, 5, 9) inhibitor .
    Fenbufen (Standard)
  • HY-B1138S
    Fenbufen-d9

    		Isotope-Labeled Compounds COX Caspase Inflammation/Immunology
    Fenbufen-d9 (CL-82204-d9) is the deuterium labeled Fenbufen. Fenbufen (CL-82204) is an orally active non-steroidal anti-inflammatory drug (NSAID), with antipyretic effects. Fenbufen has potent activity in a variety of animal model, including carageenin edema, UV erythema and adjuvant arthritis. Fenbufen has inhibitory activities against COX-1 and COX-2 with IC50s of 3.9 μM and 8.1 μM, respectively. Fenbufen is a caspases (caspase-1, 3, 4, 5, 9) inhibitor .
    Fenbufen-d9
  • HY-100754C
    Ritlecitinib tosylate
    5+ Cited Publications

    PF-06651600 tosylate

    		 JAK Interleukin Related STAT Inflammation/Immunology
    Ritlecitinib (PF-06651600) tosylate is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib tosylate rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib tosylate can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
    Ritlecitinib tosylate
  • HY-100754
    Ritlecitinib
    5+ Cited Publications

    PF-06651600

    		 JAK Interleukin Related STAT Inflammation/Immunology
    Ritlecitinib (PF-06651600) is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
    Ritlecitinib
  • HY-100754A
    Ritlecitinib (malonate)

    PF-06651600 (malonate)

    		 JAK Interleukin Related STAT Inflammation/Immunology
    Ritlecitinib (PF-06651600) malonate is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib malonate rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib malonate can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
    Ritlecitinib (malonate)
  • HY-151093
    IDO2-IN-1
    2 Publications Verification

    		 Indoleamine 2,3-Dioxygenase (IDO) Inflammation/Immunology
    IDO2-IN-1 is an orally active and potent Indoleamine 2,3-dioxygenase 2 (IDO2) inhibitor with an IC50 value of 112 nM. IDO2-IN-1 can be used for inflammatory autoimmunity research .
    IDO2-IN-1
  • HY-153808A
    Incomplete Freund's adjuvant (IFA)
    2 Publications Verification

    Montanide ISA-51

    		 Bacterial Inflammation/Immunology Cancer
    Incomplete Freund's adjuvant (IFA) (Montanide ISA-51) is an immunoadjuvant emulsified with antigen by its discoverer Jules T. Freund. Incomplete Freund's adjuvant (IFA) does not contain inactivated tuberculosis bacilli and consists of petroleum jelly containing lanolin. Incomplete Freund's adjuvant (IFA) induces high antibody titers and long-lasting effector T cell responses with no long-term effects on collagen disease, tumors, or death. Complete Freund's adjuvant (CFA) (HY-153808) is another type of Freund's Adjuvant that stimulates a stronger immune response .
    Incomplete Freund's adjuvant (IFA)
  • HY-153808
    Complete Freund's adjuvant (CFA)
    Maximum Cited Publications
    8 Publications Verification

    		 Toll-like Receptor (TLR) Inflammation/Immunology
    Complete Freund's adjuvant (CFA) is an immunoadjuvant emulsified with antigen by its discoverer Jules T. Freund to enhance an animal's immune response to an antigen. Complete Freund's adjuvant (CFA) is also an inducer of the Th1 immune response and a ligand of TLRs. Complete Freund's adjuvant (CFA) contains heat-killed inactive tuberculosis bacilli and consists of a paraffin oil-in-water emulsion. Complete Freund's adjuvant (CFA) stimulates a strong and durable immune response and can be used to induce persistent inflammatory pain models in mice, experimental autoimmune myocarditis (EAM) models, and more. Incomplete Freund's adjuvant (IFA) (HY-153808A) is another type of Freund's Adjuvant that stimulates a weaker immune response .
    Complete Freund's adjuvant (CFA)

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: