1. Search Result
Search Result
Isoforms Recommended: CCR1
Results for "

CCR1

" in MedChemExpress (MCE) Product Catalog:

36

Inhibitors & Agonists

2

Peptides

2

Antibodies

3

Oligonucleotides

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-124759

    CCR Inflammation/Immunology
    CCR1 antagonist 9 is a potent and selective CCR1 antagonist with an IC50 of 6.8 nM in calcium flux assay [1].
    CCR1 antagonist 9
  • HY-124668A

    CCR Others
    CCR1 antagonist 13 is a selective CCR1 small molecule antagonist [1].
    CCR1 antagonist 13
  • HY-114097A

    CCR Inflammation/Immunology
    CCR1 antagonist 11 hydrochloride (A1B1) is an orally active CCR1 antagonist with the IC50 values of 0.03 μM, 0.58 μM and 0.32 μM for hCCR1, mCCR1 and rCCR1, respectively. CCR1 antagonist 11 hydrochloride can be used in the study of rheumatoid arthritis and other related inflammatory diseases [1].
    CCR1 antagonist 11 hydrochloride
  • HY-124668

    CCR Inflammation/Immunology
    CCR1 antagonist 12 (Compound 12) is an antagonist for CCR1 with IC50 of 3 nM for human CCR1. CCR1 antagonist 12 inhibits CCL3-induced transwell chemotaxis with an IC50 of 0.009 µM. CCR1 antagonist 12 exhibits good pharmacokinetic characters in rats model [1].
    CCR1 antagonist 12
  • HY-114193

    CCR Inflammation/Immunology Endocrinology
    CCR1 antagonist 6 (compound 16q) is a chemokine receptor 1 (CCR1) antagonist, with an IC50 of 3 nM [1].
    CCR1 antagonist 6
  • HY-114194

    CCR Inflammation/Immunology Endocrinology
    CCR1 antagonist 7 (compound 16r) is a chemokine receptor 1 (CCR1) antagonist, with an IC50 of 4 nM [1].
    CCR1 antagonist 7
  • HY-15544

    CCR Inflammation/Immunology
    CCR1 antagonist 10 (example 1) is a potent and orally active CCR1 antagonist. CCR1 antagonist 10 inhibits 125I-MIP-1α binding to THP-1 cell membranes with an Ki value of 2.3 nM [1].
    CCR1 antagonist 10
  • HY-RS02147

    Small Interfering RNA (siRNA) CCR Others

    CCR1 Human Pre-designed siRNA Set A contains three designed siRNAs for CCR1 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

    CCR1 Human Pre-designed siRNA Set A
    CCR1 Human Pre-designed siRNA Set A
  • HY-RS02148

    Small Interfering RNA (siRNA) CCR Others

    Ccr1 Mouse Pre-designed siRNA Set A contains three designed siRNAs for Ccr1 gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

    Ccr1 Mouse Pre-designed siRNA Set A
    Ccr1 Mouse Pre-designed siRNA Set A
  • HY-RS02149

    Small Interfering RNA (siRNA) Others

    Ccr1 Rat Pre-designed siRNA Set A contains three designed siRNAs for Ccr1 gene (Rat), as well as a negative control, a positive control, and a FAM-labeled negative control.

    Ccr1 Rat Pre-designed siRNA Set A
    Ccr1 Rat Pre-designed siRNA Set A
  • HY-120588

    CCR1 antagonist 8

    CCR Inflammation/Immunology Endocrinology
    BI 639667 (compound 19n), a third azaindazole series compound, is a CCR1 antagonist, with an IC50 of 1.8 nM in Ca 2+ flux assay [1].
    BI 639667
  • HY-12079

    CCR Inflammation/Immunology
    CP-481715 is a potent, reversible and selective CCR1 antagonist with a Kd of 9.2 nM for human CCR1. CP-481715 is >100-fold selective for CCR1 as compared with a panel of G-protein-coupled receptors including related chemokine receptors. CP-481715 has the potential for rheumatoid arthritis and other inflammatory diseases research [1].
    CP-481715
  • HY-15546

    CCR Inflammation/Immunology
    BMS-817399 is a potent, selective, and orally bioavailable CCR1 antagonist. BMS-817399 exhibits CCR1 binding affinity and chemotaxis inhibition potencies of 1 and 6 nM (IC50), respectively. BMS-817399 can be used for the research of rheumatoid arthritis [1].
    BMS-817399
  • HY-111037

    CCR Inflammation/Immunology
    BMS-457 is a potent and selective CCR1 antagonist. BMS-457 can be used in the study of rheumatoid arthritis [1].
    BMS-457
  • HY-12080A
    BX471 hydrochloride
    15+ Cited Publications

    ZK-811752 hydrochloride

    CCR Inflammation/Immunology Endocrinology
    BX471 hydrochloride (ZK-811752 hydrochloride) is a potent, selective non-peptide CCR1 antagonist with Ki of 1 nM for human CCR1, and exhibits 250-fold selectivity for CCR1 over CCR2, CCR5 and CXCR4.
    BX471 hydrochloride
  • HY-15545

    CCR Inflammation/Immunology
    AZD-4818 is a potent, orally active antagonist of chemokine CCR1. AZD-4818 can be used for researching chronic obstructive pulmonary disease (COPD) [1].
    AZD-4818
  • HY-103360
    J-113863
    3 Publications Verification

    CCR Inflammation/Immunology
    J-113863 is a potent and selective CCR1 antagonist with IC50 values of 0.9 nM and 5.8 nM for human and mouse CCR1 receptors, respectively. J-113863 is also a potent antagonist of the human CCR3 (IC50 of 0.58 nM) , but a weak antagonist of the mouse CCR3 (IC50 of 460 nM). J-113863 is inactive against CCR2, CCR4 and CCR5, as well as the LTB4 or TNF-α receptors. Anti-inflammatory effect [1] .
    J-113863
  • HY-103360A

    UCB35625

    CCR Inflammation/Immunology
    cis-J-113863 is a competitive chemokine receptor 1 (CCR1) antagonist, with IC50 values of 0.9 and 5.8 nM for human and mouse CCR1 receptors, respectively [1].
    cis-J-113863
  • HY-12080
    BX471
    15+ Cited Publications

    ZK-811752

    CCR Inflammation/Immunology Endocrinology
    BX471 (ZK-811752) is an orally active, potent and selective non-peptide CCR1 antagonist with a Ki of 1 nM, and exhibits 250-fold selectivity for CCR1 over CCR2, CCR5 and CXCR4.
    BX471
  • HY-U00350
    CCX354
    1 Publications Verification

    CCR Inflammation/Immunology Endocrinology
    CCX354 is an antagonist of CCR1, with anti-inflammatory activity.
    CCX354
  • HY-18611A
    RS102895
    20+ Cited Publications

    CCR Neurological Disease Endocrinology
    RS102895 is a potent CCR2 antagonist, with an IC50 of 360 nM, and shows no effect on CCR1.
    RS102895
  • HY-18611
    RS102895 hydrochloride
    20+ Cited Publications

    CCR Neurological Disease Endocrinology
    RS102895 hydrochloride is a potent CCR2 antagonist, with an IC50 of 360 nM, and shows no effect on CCR1.
    RS102895 hydrochloride
  • HY-103360B

    CCR Inflammation/Immunology
    trans-J-113863 is a potent chemokine CCR1 and CCR3 receptor antagonist, and inhibits MIP-1α-induced chemotaxis in CCR1 transfectants and eotaxin-induced chemotaxis in CCR3 transfectants with IC50 of 9.57 and 93.8 nM,respectively [1] .
    trans-J-113863
  • HY-163761

    CCR Others
    LT166 is a fluorescent ligand for CC chemokine receptor 1 (CCR1) with a KD of 1.90 μM [1].
    LT166
  • HY-171476

    CCR Inflammation/Immunology
    CP-865569 is a CCR1 antagonist. CP-865569 can be used in the research of inflammatory diseases and autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis [1].
    CP-865569
  • HY-15418
    RS 504393
    Maximum Cited Publications
    24 Publications Verification

    CCR Inflammation/Immunology Endocrinology
    RS 504393 is a selective CCR2 chemokine receptor antagonist (IC50 values are 89 nM and > 100 μM for inhibition of human recombinant CCR2 and CCR1 receptors respectively).
    RS 504393
  • HY-148232

    CCR Inflammation/Immunology
    BAY-3153 is a selective CCR1 (C-C motif chemokine receptor 1) antagonist (human IC50=3 nM; rat IC50=11 nM; mice IC50=81 nM) [1].
    BAY-3153
  • HY-15418R

    CCR Inflammation/Immunology Endocrinology
    RS 504393 (Standard) is the analytical standard of RS 504393. This product is intended for research and analytical applications. RS 504393 is a selective CCR2 chemokine receptor antagonist (IC50 values are 89 nM and > 100 μM for inhibition of human recombinant CCR2 and CCR1 receptors respectively).
    RS 504393 (Standard)
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) [1].
    Met-RANTES (human)
  • HY-P4191A

    CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) [1].
    Met-RANTES (human) acetate
  • HY-112701
    CCR6 inhibitor 1
    5+ Cited Publications

    CCR Inflammation/Immunology Endocrinology Cancer
    CCR6 inhibitor 1 is a potent and selective CCR6 inhibitor, with IC50s of 0.45 and 6 nM for monkey and human CCR6, much more selective at CCR6 over human CCR1 (IC50, > 30000 nM), and CCR7 (IC50, 9400 nM). CCR6 inhibitor 1 markedly blocks ERK phosphorylation. CCR6 inhibitor 1 is used in the research of autoimmune diseases and cancer [1].
    CCR6 inhibitor 1
  • HY-15724A
    Vercirnon sodium
    3 Publications Verification

    GSK-1605786 sodium; CCX282-B sodium; Traficet-EN sodium

    CCR Inflammation/Immunology Endocrinology
    Vercirnon (GSK1605786A) sodium is an orally bioavailable, selective, and potent antagonist of CCR9. Vercirnon sodium inhibits CCR9-mediated Ca 2+ mobilization and chemotaxis on Molt-4 cells with IC50 values of 5.4 and 3.4 nM, respectively. Vercirnon sodium is selective for CCR9 over CCR1-12 and CX3CR1-7 (IC50s>10 μM for all). Vercirnon sodium is an equipotent inhibitor of CCL25-directed chemotaxis of both splice forms of CCR9 (CCR9A and CCR9B) with IC50 values of 2.8 and 2.6 nM, respectively [1].
    Vercirnon sodium
  • HY-15724
    Vercirnon
    3 Publications Verification

    GSK-1605786; CCX282-B; Traficet-EN

    CCR Inflammation/Immunology Endocrinology
    Vercirnon (GSK1605786A) is an orally bioavailable, selective, and potent antagonist of CCR9. Vercirnon inhibits CCR9-mediated Ca 2+ mobilization and chemotaxis on Molt-4 cells with IC50 values of 5.4 and 3.4 nM, respectively. Vercirnon is selective for CCR9 over CCR1-12 and CX3CR1-7 (IC50s>10 μM for all). Vercirnon is an equipotent inhibitor of CCL25-directed chemotaxis of both splice forms of CCR9 (CCR9A and CCR9B) with IC50 values of 2.8 and 2.6 nM, respectively [1].
    Vercirnon
  • HY-15724R

    CCR Inflammation/Immunology Endocrinology
    Vercirnon (Standard) is the analytical standard of Vercirnon. This product is intended for research and analytical applications. Vercirnon (GSK1605786A) is an orally bioavailable, selective, and potent antagonist of CCR9. Vercirnon inhibits CCR9-mediated Ca2+ mobilization and chemotaxis on Molt-4 cells with IC50 values of 5.4 and 3.4 nM, respectively. Vercirnon is selective for CCR9 over CCR1-12 and CX3CR1-7 (IC50s>10 μM for all). Vercirnon is an equipotent inhibitor of CCL25-directed chemotaxis of both splice forms of CCR9 (CCR9A and CCR9B) with IC50 values of 2.8 and 2.6 nM, respectively [1].
    Vercirnon (Standard)
  • HY-15724AR

    CCR Inflammation/Immunology Endocrinology
    Vercirnon (sodium) (Standard) is the analytical standard of Vercirnon (sodium). This product is intended for research and analytical applications. Vercirnon (GSK1605786A) sodium is an orally bioavailable, selective, and potent antagonist of CCR9. Vercirnon sodium inhibits CCR9-mediated Ca2+ mobilization and chemotaxis on Molt-4 cells with IC50 values of 5.4 and 3.4 nM, respectively. Vercirnon sodium is selective for CCR9 over CCR1-12 and CX3CR1-7 (IC50s>10 μM for all). Vercirnon sodium is an equipotent inhibitor of CCL25-directed chemotaxis of both splice forms of CCR9 (CCR9A and CCR9B) with IC50 values of 2.8 and 2.6 nM, respectively [1].
    Vercirnon sodium (Standard)
  • HY-19974
    TAK-220
    2 Publications Verification

    CCR HIV Infection Endocrinology
    TAK-220 is a selective and orally bioavailable CCR5 antagonist, with IC50s of 3.5 nM and 1.4 nM for inhibition on the binding of RANTES and MIP-1α to CCR5, respectively, but shows no effect on the binding to CCR1, CCR2b, CCR3, CCR4, or CCR7; TAK-220 also selectively inhibits HIV-1, with EC50s of 1.2 nM (HIV-1 KK), 0.72 nM (HIV-1 CTV), 1.7 nM (HIV-1 HKW), 1.7 nM (HIV-1 HNK), 0.93 nM (HIV-1 HTN), and 0.55 nM (HIV-1 HHA), and EC90s of 12 nM (HIV-1 KK), 5 nM (HIV-1 CTV), 12 nM (HIV-1 HKW), 28 nM (HIV-1 HNK), 15 nM (HIV-1 HTN), and 4 nM (HIV-1 HHA) in PBMCs.
    TAK-220

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: