1. Search Result
Search Result
Results for "

AIA

" in MedChemExpress (MCE) Product Catalog:

14

Inhibitors & Agonists

3

Peptides

3

Natural
Products

2

Recombinant Proteins

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-P4191A

    CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) (acetate)
  • HY-N7703

    Others Inflammation/Immunology
    D-Mannuronic acid sodium, isolated from Macrocystis pyrifera, has the potential in autoimmune encephalomyelitis (EAE), adjuvant induced arthritis (AIA), nephrotic syndrome, and acute glomerulonephritis studies .
    D-Mannuronic acid sodium
  • HY-10413
    MK-2894
    2 Publications Verification

    Prostaglandin Receptor Inflammation/Immunology Endocrinology
    MK-2894 is a potent, selective, orally active and high affinity (Ki=0.56 nM) full antagonist against E prostanoid receptor 4 (EP4 receptor) (IC50=2.5 nM). MK-2894 possesses potent anti-inflammatory activity in animal models of pain/inflammation and can be used for the research of arthritis .
    MK-2894
  • HY-W016814
    (Z)-Aconitic acid
    1 Publications Verification

    cis-Aconitic acid

    Endogenous Metabolite Amino Acid Decarboxylase Metabolic Disease Inflammation/Immunology
    (Z)-Aconitic acid is an orally active glutamate decarboxylase inhibitor. (Z)-Aconitic acid reduces IκB-α phosphorylation. (Z)-Aconitic acid inhibits Antigen-induced arthritis and Monosodium urate (HY-B2130A)-induced gout .
    (Z)-Aconitic acid
  • HY-115487

    Prostaglandin Receptor Inflammation/Immunology Cancer
    MF-766 is a highly potent, selective and orally active EP4 antagonist with a Ki of 0.23 nM. MF-766 behaves as a full antagonist with an IC50 of 1.4 nM (shifted to 1.8 nM in the presence of 10% HS) in the functional assay. MF-766 can be used for cancer and inflammation diseases research .
    MF-766
  • HY-N13305

    Others Others
    Aristolactam AIa is a natural product .
    Aristolactam AIa
  • HY-P1360

    Drug Derivative Metabolic Disease
    H-D-MeAla-EtVaI-VaI-MeLeu-AIa-D-AIa-MeLeu-MeLeu-MeVaI-MeBmt(OAc)-Abu-O-CH2-CH2-NHMe is a nonimmunosuppressive cyclosporin A derivative. H-D-MeAla-EtVaI-VaI-MeLeu-AIa-D-AIa-MeLeu-MeLeu-MeVaI-MeBmt(OAc)-Abu-O-CH2-CH2-NHMe has the potential for the research of congenital muscular dystrophy .
    H-D-MeAla-EtVaI-VaI-MeLeu-AIa-D-AIa-MeLeu-MeLeu-MeVaI-MeBmt(OAc)-Abu-O-CH2-CH2-NHMe
  • HY-135081

    N-4AIA

    COX Others
    N-(4-acetamidophenyl)-indomethacin amide (N-4-AIA) is one of several aromatic amides of indomethacin reported to be potent and selective reversible inhibitors of COX-2.1 N-4-AIA inhibits human recombinant and ovine COX-2 with IC50 values of 0.12 and 0.625 μM, respectively. It is about 400 times less potent as an inhibitor of human recombinant COX-1 and 80 times less potent as an inhibitor of ovine COX-1 than ovine COX-2.
    N-(4-acetamidophenyl)-Indomethacin amide
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-10414

    Prostaglandin Receptor Inflammation/Immunology Endocrinology
    MK-2894 sodium salt is a potent, selective, orally active and high affinity (Ki=0.56 nM) full antagonist against E prostanoid receptor 4 (EP4 receptor) (IC50=2.5 nM). MK-2894 sodium salt possesses potent anti-inflammatory activity in animal models of pain/inflammation and can be used for the research of arthritis .
    MK-2894 sodium salt
  • HY-115913

    Phosphodiesterase (PDE) Inflammation/Immunology
    PDE4-IN-6 is a potent, safe and moderately selective PDE4 inhibitor with IC50s of 0.125 and 0.43 µM for PDE4B and PDE4D, respectively. PDE4-IN-6 can downregulate the expression level of TNF-α and IL-6. PDE4-IN-6 has potent immunomodulatory activity thereby its potential against rheumatoid arthritis. Anti-inflammatory and anti-arthritic effects .
    PDE4-IN-6
  • HY-10999
    Trametinib
    Maximum Cited Publications
    211 Publications Verification

    GSK1120212; JTP-74057

    MEK Autophagy Apoptosis Cancer
    Trametinib (GSK1120212; JTP-74057) is an orally active MEK inhibitor that inhibits MEK1 and MEK2 with IC50s of about 2 nM. Trametinib activates autophagy and induces apoptosis .
    Trametinib
  • HY-10999R

    MEK Autophagy Apoptosis Cancer
    Trametinib (Standard) is the analytical standard of Trametinib. This product is intended for research and analytical applications. Trametinib (GSK1120212; JTP-74057) is an orally active MEK inhibitor that inhibits MEK1 and MEK2 with IC50s of about 2 nM. Trametinib activates autophagy and induces apoptosis .
    Trametinib (Standard)
  • HY-10999A
    Trametinib (DMSO solvate)
    Maximum Cited Publications
    211 Publications Verification

    GSK-1120212 (DMSO solvate); JTP-74057 (DMSO solvate)

    MEK Apoptosis Cancer
    Trametinib (DMSO solvate) (GSK-1120212 (DMSO solvate);JTP-74057 (DMSO solvate)) is an orally active MEK inhibitor that inhibits MEK1 and MEK2 with IC50s of about 2 nM. Trametinib (DMSO solvate) activates autophagy and induces apoptosis .
    Trametinib (DMSO solvate)

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: