1. Recombinant Proteins
  2. Receptor Proteins Others
  3. G-Protein-Coupled Receptors (GPCRs)
  4. TSC22/TSC22D1 Protein, Human (His)

TSC22D1 Protein, a positive modulator of cell death during mammary gland involution in response to TGFB3, forms a heterodimer with TSC22D4/THG1. Its interactions with histone H1-2 and GNL3 underscore TSC22D1's versatile role in molecular processes, emphasizing its potential significance in various cellular contexts. TSC22/TSC22D1 Protein, Human (His) is the recombinant human-derived TSC22/TSC22D1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TSC22D1 Protein, a positive modulator of cell death during mammary gland involution in response to TGFB3, forms a heterodimer with TSC22D4/THG1. Its interactions with histone H1-2 and GNL3 underscore TSC22D1's versatile role in molecular processes, emphasizing its potential significance in various cellular contexts. TSC22/TSC22D1 Protein, Human (His) is the recombinant human-derived TSC22/TSC22D1 protein, expressed by E. coli , with N-His labeled tag.

Background

TSC22D1, a protein integral to the regulation of cellular processes, acts as a positive modulator of cell death in response to TGFB3 during mammary gland involution. Notably, it forms a heterodimer with TSC22D4/THG1, indicating its involvement in complex interactions that contribute to cellular functions. Additionally, TSC22D1 exhibits interactions with histone H1-2 and GNL3, underlining its versatile role in molecular processes and highlighting its potential significance in various cellular contexts.

Biological Activity

Measured by its ability to inhibit the cell growth of Hela cells. The ED50 for this effect is 0.6712 μg/mL, corresponding to a specific activity is 1.489×103 units/mg.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q15714-2 (M1-A144)

Gene ID
Molecular Construction
N-term
His
TSC22 (M1-A144)
Accession # Q15714-2
C-term
Synonyms
TSC22 domain family protein 1; Cerebral protein 2; KIAA1994; TGFB1I4
AA Sequence

MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA

Molecular Weight

Approximately 19-20 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TSC22/TSC22D1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TSC22/TSC22D1 Protein, Human (His)
Cat. No.:
HY-P76685
Quantity:
MCE Japan Authorized Agent: