TRGC2 Protein, Human (HEK293, His)

TRGC2 Protein, Human (HEK293, His) is the recombinant human-derived TRGC2 protein, expressed by HEK293, with C-His tag.

TRGC2 is the constant region of the T cell receptor (TR) gamma chain, involved in antigen recognition. Gamma-delta TRs recognize a variety of self and foreign non-peptide antigens, often expressed at epithelial boundaries between the host and external environment, including endogenous lipids presented by MH-like protein CD1D and phosphoantigens presented by butyrophilin-like molecule BTN3A1. Upon antigen recognition, TRGC2 triggers rapid, innate-like immune responses for pathogen clearance and tissue repair. Binding of the gamma-delta TR complex to antigen induces phosphorylation of immunoreceptor tyrosine-based activation motifs (ITAMs) in CD3 chains by LCK and FYN kinases, recruiting and activating ZAP70, which phosphorylates scaffolding proteins LCP2 and LAT. This leads to the formation of a supramolecular signalosome that recruits phospholipase PLCG1, resulting in calcium mobilization and ERK activation, ultimately driving T cell expansion and differentiation into effector cells. Gamma-delta TRs are generated through somatic rearrangement of a limited repertoire of variable (V), diversity (D), and joining (J) genes, with diversity enhanced by tandem D gene rearrangement, utilization of all three reading frames, and exonuclease trimming plus random nucleotide (N) region additions during V-(D)-J recombination.

Human

HEK293

C-His

P03986 (D1-A154)

/

Partial

DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDIIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGIDQEIIFPPIKTDVTTVDPKYNYSKDANDVITMDPKDNWSKDANDTLLLQLTNTSA

Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.