1. Recombinant Proteins
  2. TPO/Thrombopoietin Protein, Human (HEK293)

TPO/Thrombopoietin Protein, a lineage-specific cytokine, significantly influences megakaryocyte proliferation and maturation, particularly in late developmental stages from committed progenitor cells. It emerges as a potential major physiological regulator, underscoring its crucial role in the intricate orchestration of circulating platelets and emphasizing its importance in megakaryocyte biology and platelet formation. TPO/Thrombopoietin Protein, Human (HEK293) is the recombinant human-derived TPO/Thrombopoietin protein, expressed by HEK293, with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TPO/Thrombopoietin Protein, a lineage-specific cytokine, significantly influences megakaryocyte proliferation and maturation, particularly in late developmental stages from committed progenitor cells. It emerges as a potential major physiological regulator, underscoring its crucial role in the intricate orchestration of circulating platelets and emphasizing its importance in megakaryocyte biology and platelet formation. TPO/Thrombopoietin Protein, Human (HEK293) is the recombinant human-derived TPO/Thrombopoietin protein, expressed by HEK293, with tag free.

Background

Thrombopoietin (TPO), a lineage-specific cytokine, exerts a pivotal influence on the proliferation and maturation of megakaryocytes, particularly at the late stages of their development from committed progenitor cells. Notably, TPO emerges as a potential major physiological regulator in the intricate orchestration of circulating platelets, underscoring its crucial role in megakaryocyte biology and platelet formation.

Biological Activity

Human Thrombopoietin Protein, premium grade stimulates proliferation of Mo7e cells. The specific activity of Human Thrombopoietin Protein, premium grade is > 1.0×107 IU/mg.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P40225-1 (S22-G353)

Gene ID

7066

Molecular Construction
N-term
(S22-G353)
Accession # P40225-1
C-term
Synonyms
Thrombopoietin; C-mpl ligand; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; Myeloproliferative leukemia virus oncogene ligand; THPO
AA Sequence

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Predicted Molecular Mass
35.5 kDa
Molecular Weight

Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of 20 mM NaAc-HAc, pH5.0 with 11% trehalose as protectant.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TPO/Thrombopoietin Protein, Human (HEK293)
Cat. No.:
HY-P704528
Quantity:
MCE Japan Authorized Agent: