1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. Osteoprotegerin
  6. TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag)

TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag)

Cat. No.: HY-P700432
Handling Instructions Technical Support

TNFRSF11B/OPG acts as a decoy receptor for TNFSF11/RANKL, neutralizing its osteoclastic effects and promoting osteoclast apoptosis in vitro. It regulates the TNFSF11/TNFRSF11B ratio and is critical for bone homeostasis. TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived TNFRSF11B/OPG protein, expressed by HEK293 , with C-hFc, C-Flag labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNFRSF11B/OPG acts as a decoy receptor for TNFSF11/RANKL, neutralizing its osteoclastic effects and promoting osteoclast apoptosis in vitro. It regulates the TNFSF11/TNFRSF11B ratio and is critical for bone homeostasis. TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived TNFRSF11B/OPG protein, expressed by HEK293 , with C-hFc, C-Flag labeled tag.

Background

TNFRSF11B/OPG acts as a decoy receptor for TNFSF11/RANKL, effectively neutralizing its function in osteoclastogenesis. Inhibiting the activation of osteoclasts, it promotes their apoptosis in vitro, highlighting its critical role in bone homeostasis by modulating the local ratio between TNFSF11 and TNFRSF11B. Furthermore, TNFRSF11B may play a role in preventing arterial calcification and act as a decoy receptor for TNFSF10/TRAIL, offering protection against apoptosis. The homodimeric structure of TNFRSF11B underscores its ability to interact with TNFSF10 and TNFSF11, thus regulating essential pathways in bone metabolism and cellular survival.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 at 10 μg/ml can bind human TNFRSF11B, the EC50 is 2.651-7.646 ng/ml.

Species

Human

Source

HEK293

Tag

C-hFc;C-Flag

Accession

O00300 (E22-L401)

Gene ID
Molecular Construction
N-term
TNFRSF11B (E22-L401)
Accession # O00300
hFc-Flag
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Tumor Necrosis Factor Receptor Superfamily Member 11B; Osteoclastogenesis Inhibitory Factor; Osteoprotegerin; TNFRSF11B; OCIF; OPG
AA Sequence

ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

Molecular Weight

85kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag)
Cat. No.:
HY-P700432
Quantity:
MCE Japan Authorized Agent: