1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Serine/Threonine Kinase Proteins
  4. TGF-beta Receptor TGF-beta Receptor 2
  5. TGFBR2/TGF-beta RII Protein, Mouse (HEK293, His)

TGFBR2/TGF-beta RII Protein, Mouse (HEK293, His)

Cat. No.: HY-P7428
Handling Instructions Technical Support

TGFBR2/TGF-beta RII Protein, Mouse (HEK293, His), His consists of N-terminal ectodomain and C-terminal protein kinase domain with his tag.TGF-beta receptor type-2 is the ligand-binding receptor for all members of the TGF-β family.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TGFBR2/TGF-beta RII Protein, Mouse (HEK293, His), His consists of N-terminal ectodomain and C-terminal protein kinase domain with his tag.TGF-beta receptor type-2 is the ligand-binding receptor for all members of the TGF-β family.

Background

Transforming growth factor-beta (TGF-β) is a pleiotropic cytokine with the capability to act as tumor suppressor or tumor promoter depending on the cellular context. TGF-beta receptor type-2 (TGFBR2) is the ligand-binding receptor for all members of the TGF-βfamily and expressed in virtually all cell types including fibroblasts. Regulation of tumor-stromal cross-talk through fibroblastic TGF-βpathway may depend on fibroblast phenotype, emphasising the importance to characterise tumor microenvironment subtypes[1].

Biological Activity

Measured by its ability to inhibit TGF-beta 1 activity on HT-2 mouse T cells. The ED50 for this effect is 7.946 ng/mL in the presence of 1 ng/mL of rhTGF-beta 1 (HY-P7118), corresponding to a specific activity is 1.258×105 units/mg.

  • Measured by its ability to inhibit TGF-beta 1 activity on HT-2 mouse T cells. The ED50 for this effect is 7.946 ng/mL in the presence of 1 ng/mL of rhTGF-beta 1 (HY-P7118), corresponding to a specific activity is 1.258×105 units/mg.
Species

Mouse

Source

HEK293

Tag

N-6*His

Accession

Q62312-2 (I24-D159)

Gene ID
Molecular Construction
N-term
6*His
TGFBR2 (I24-D159)
Accession # Q62312-2
C-term
Protein Length

Partial

Synonyms
TGFR-2; TGF-beta type II receptor; TGF-beta receptor type 2; TbetaR-II
AA Sequence

IPPHVPKSVNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPDHHHHHH

Molecular Weight

25-38 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGFBR2/TGF-beta RII Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7428
Quantity:
MCE Japan Authorized Agent: