1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β TGF-β
  5. TGF-β1
  6. TGF beta 1/TGFB1 Protein, Human (CHO)

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Human is a recombinant protein (A279-S390) produced by CHO cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE TGF beta 1/TGFB1 Protein, Human (CHO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Human is a recombinant protein (A279-S390) produced by CHO cells[1][2].

Background

TGF beta 1/TGFB1 Protein (transforming growth factor beta 1) is a multifunctional cytokine, which is synthesized by almost all cells. TGF beta 1/TGFB1 Protein has a high ability to bind with TGFbRII[3].
The sequence of amino acids in TGFb1 proteins from different species is very stable, which leads to the conclusion that in the process of evolution, TGFb has been only slightly altered, and that both in humans and in animals, its function is similar. TGF beta 1/TGFB1 Protein is secreted as an inactive peptide, forming part of a ‘latent complex’ consisting of a mature TGFB1 dimer non-covalently bound to its latency-associated peptide (LAP) and, via LAP, to latent TGFB-binding proteins (LTBPs). Activated TGF beta 1/TGFB1 Protein binds to ubiquitously expressed cell-surface TGFB1 type I receptors (TGFBRI) and type II receptors (TGFBRII), which are transmembrane serine/threonine kinases[4].
TGF beta 1/TGFB1 Protein regulates cell proliferation, growth, differentiation and cells movement. TGFb1 has immunomodulatory effects. TGF beta 1/TGFB1 Protein has profibrogenic effects. TGF beta 1/TGFB1 Protein action can be local and systemic. TGF beta 1/TGFB1 Protein plays a driving role in development, fibrosis and cancer[4].

In Vitro

TGFB1 human (0.2 ng/mL) upregulates LINC00941[5].
TGF-β1 (0.2 ng/mL) significantly and maximally inhibits the growth of MLE cells[6].
TGF–β1 (5 ng/ml) results in a significant increase in the protein and mRNA levels of IL-6 in HTM cells[7].

Biological Activity

1. The ED50 is <0.2 ng/mL as measured in ability to inhibit the mouse IL-4-dependent proliferation of HT-2 cells.
2. The ability to inhibit the IL-4-dependent proliferation of TF 1 human erythroleukemic cells has an ED50 value of 4-40 pg/mL.
3. Measured by its ability to inhibit cell proliferation of Mv-1-lu mink lung epithelial cells. The ED50 for this effect is <0.1 ng/mL, corresponding to a specific activity is >1×107 units/mg.

  • Measured by its ability to inhibit cell proliferation of Mv-1-lu mink lung epithelial cells. The ED50 for this effect is 0.09738 ng/mL, corresponding to a specific activity is 1.027×107 units/mg.
Species

Human

Source

CHO

Tag

Tag Free

Accession

P01137 (A279-S390)

Gene ID
Molecular Construction
N-term
TGFB1 (A279-S390)
Accession # P01137
C-term
Protein Length

Full Length of Mature TGFB1

Synonyms
TGF-beta-1; TGFB1; TGFB; rHuTGF-β1
AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Weight

Approximately 12-14 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM NaAc, 50 mM NaCl, pH 5.0 or 50 mM Glycine-HCl, 150 mM NaCl, pH 2.5 or 4 mM HCL.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or diluted with 50 mM Citrate. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TGF beta 1/TGFB1 Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGF beta 1/TGFB1 Protein, Human (CHO)
Cat. No.:
HY-P7118
Quantity:
MCE Japan Authorized Agent: