1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL17
  6. TARC/CCL17 Protein, Human (HEK293, His)

TARC/CCL17 Protein, Human (HEK293, His) is the first CC chemokine identified to interact with T cells with high affinity and bind to the CCR4 receptor to mediate inflammation, cancer, and autoimmune related diseases. TARC/CCL17 Protein, Human (HEK293, His) is a recombinant human TARC/CCL17(A24-S94) protein expressed by HEK293 with a his tag at C end.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE TARC/CCL17 Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TARC/CCL17 Protein, Human (HEK293, His) is the first CC chemokine identified to interact with T cells with high affinity and bind to the CCR4 receptor to mediate inflammation, cancer, and autoimmune related diseases. TARC/CCL17 Protein, Human (HEK293, His) is a recombinant human TARC/CCL17(A24-S94) protein expressed by HEK293 with a his tag at C end[1][2].

Background

CCL17, also known as thymic and activating regulatory chemokine (TARC), is a powerful chemokine commonly associated with type 2 immune responses, and its encoding gene is located on chromosome 16 in humans. CCL17 can be produced by thymic and antigen-presenting cells such as dendritic cells, macrophages, and monocytes, and acts by binding to the cell surface chemokine receptor CCR4. CCR4 is a G protein-coupled receptor expressed as a chemokine receptor on Th2 cells, cutaneous lymphocytes skin-localized T cells and regulatory T cells, and also on T cells in adult T-cell leukemia/lymphoma and cutaneous T-cell lymphoma. CCR4 has an important role in the regulation of immune homeostasis and activation of innate immune cells in the central nervous system (CNS). CCL17 plays an important role in the recruitment of CCR4-positive Th2 lymphocytes, is involved in the transport of Th2 cells in eosinophil-associated diseases (including AA and AD) and may be involved in the transport of tumor cells in certain T-cell lymphomas.CCL17 is also thought to be a homeostatic and inducible neuromodulatory chemokine that maintains the typical highly branching morphology of hippocampal microglia under homeostatic conditions and promotes adaptation of microglia morphology to acute LPS-induced neuroinflammation. CCL17 is also associated with autoimmune and allergic disorders[1][2].

In Vitro

CCL17 (0-1 ng/mL) can significantly induce CD4+ CD25+ cell migration, but not CD4+ CD25-cell migration in a dose-dependent manner in the cells purified from regional lymph nodes of gastric cancer patients[3].
CCL17 (10-1,000 ng/mL, 12-48 h) can induce cell migration in human epithelial colon adenocarcinoma cell line HT-29 and is dependent on CCR4-mediated RhoA/Rho-kinase signaling, and CCL17-induced cell migration can be inhibited by preincubation with antibodies against CCR4 or antagonists against CCR4[4].

Biological Activity

Measured by its ability to chemoattract Jurkat human lymphoma cells. The ED50 for this effect is 5.437 ng/mL, corresponding to a specific activity is 1.839×105 U/mg.

  • Measured by its ability to chemoattract Jurkat human lymphoma cells. The ED50 for this effect is 5.437 ng/mL, corresponding to a specific activity is 1.839×105 U/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q92583 (A24-S94)

Gene ID
Molecular Construction
N-term
CCL17 (A24-S94)
Accession # Q92583
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuCCL17, His; C-C motif chemokine 17; CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine; CCL17; SCYA17; TARC
AA Sequence

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERSHHHHHH

Predicted Molecular Mass
8.1 kDa
Molecular Weight

Approximately 10-13 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris,150 mM NaCl, pH 8.0 or 20 mM His-HCl,10% Trehalose, 5% Maltose, 100 mM NaCl, 0.1% Tween 80, pH 6.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TARC/CCL17 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TARC/CCL17 Protein, Human (HEK293, His)
Cat. No.:
HY-P7759
Quantity:
MCE Japan Authorized Agent: