1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. ST2/IL1RL1 Protein, Human (310a.a, HEK293, His)

ST2/IL1RL1 Protein, Human (310a.a, HEK293, His)

Cat. No.: HY-P70615
Handling Instructions Technical Support

ST2/IL1RL1 Protein potently inhibits IL-33 signaling. ST2/IL1RL1 Protein, Human (310a.a, HEK293, His) is the recombinant human-derived ST2/IL1RL1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE ST2/IL1RL1 Protein, Human (310a.a, HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ST2/IL1RL1 Protein potently inhibits IL-33 signaling. ST2/IL1RL1 Protein, Human (310a.a, HEK293, His) is the recombinant human-derived ST2/IL1RL1 protein, expressed by HEK293 , with C-His labeled tag.

Background

ST2/IL1RL1 protein serves as a potent inhibitor of IL-33 signaling.

Biological Activity

1.Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 0.7922 ng/mL in the presence of 10 ng/mL recombinant mouse IL-33, corresponding to a specific activity is 1.2623×106 units/mg.
2.Measured by its ability to bind human IL33 in functional Elisa.
3. Loaded ST2/IL1RL1 Protein, Human (310a.a, HEK293, His) on AHC2 biosensor, can bind Astegolimab (HY-P99444) with an affinity constant of 2.022E-10 M as determined in BLI assay.

  • Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 0.7922 ng/mL in the presence of 10 ng/mL recombinant mouse IL-33, corresponding to a specific activity is 1.2623×106 units/mg.
  • Loaded ST2/IL1RL1 Protein, Human (310a.a, HEK293, His) on AHC2 biosensor, can bind Astegolimab (HY-P99444) with an affinity constant of 2.022E-10 M as determined in BLI assay.
Species

Human

Source

HEK293

Tag

C-His

Accession

Q01638-2 (K19-F328)

Gene ID
Molecular Construction
N-term
ST2 (K19-F328)
Accession # Q01638-2
His
C-term
Protein Length

Extracellular Domain

Synonyms
Interleukin-1 receptor-like 1; Protein ST2; DER4; ST2; T1
AA Sequence

KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF

Molecular Weight

52-60 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ST2/IL1RL1 Protein, Human (310a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ST2/IL1RL1 Protein, Human (310a.a, HEK293, His)
Cat. No.:
HY-P70615
Quantity:
MCE Japan Authorized Agent: