1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. SPINK4 Protein, Human (HEK293, His)

SPINK4 Protein is a member of the serine protease inhibitors family named Kazal type (SPINK) in humans. SPINK4 is known as a gastrointestinal peptide in the gastrointestinal tract and is abundantly expressed in human goblet cells. SPINK4 can serve as a prognostic marker for colorectal cancer (CRC), bladder cancer (BCa) and Barrett's esophagus. The reduced expression of SPINK4 relates to poor survival in colorectal cancer (CRC). SPINK4 Protein, Human (HEK293, His) is the recombinant human-derived SPINK4 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

SPINK4 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SPINK4 Protein is a member of the serine protease inhibitors family named Kazal type (SPINK) in humans. SPINK4 is known as a gastrointestinal peptide in the gastrointestinal tract and is abundantly expressed in human goblet cells. SPINK4 can serve as a prognostic marker for colorectal cancer (CRC), bladder cancer (BCa) and Barrett's esophagus. The reduced expression of SPINK4 relates to poor survival in colorectal cancer (CRC)[1][2]. SPINK4 Protein, Human (HEK293, His) is the recombinant human-derived SPINK4 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The SPINK4 gene of human chromosome 9p13.3 encodes a precursor protein consisting of 86 amino acids. The precursor protein consists of 26 amino acids, which are characterized by a C-terminal cysteine, an N-terminal glutamate and a cell secretion mark. A total of 60 residues of, are believed to be involved in the defense against degradation of mucosal and epithelial tissue proteins[1].
One branch of the family of serine protease inhibitors is named Kazal type (SPINK) and originally consisted of four members in humans (SPINK1, SPINK2, SPINK4, and SPINK5). Although the major site of expression of all four SPINK members may differ, all are thought to be involved in protection against proteolytic degradation of epithelial and mucosal tissues[2].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O60575 (G27-C86)

Gene ID
Molecular Construction
N-term
SPINK4 (G27-C86)
Accession # O60575
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Serine Protease Inhibitor Kazal-Type 4; Peptide PEC-60 Homolog; SPINK4
AA Sequence

GKLPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQDIQIMKDGKC

Molecular Weight

Approximately 10-13 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.2 μm filtered solution of PBS, 1 mM EDTA, 5% Trehalose, pH 7.4.
2.Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SPINK4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPINK4 Protein, Human (HEK293, His)
Cat. No.:
HY-P71035
Quantity:
MCE Japan Authorized Agent: