1. Recombinant Proteins
  2. CAR-T Related Proteins Receptor Proteins Enzymes & Regulators Biotinylated Proteins
  3. ROR1 Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. ROR family
  5. ROR1 Protein, Human (Biotinylated, HEK293, His-Avi)

ROR1 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P72410
Handling Instructions Technical Support

ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived ROR1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ROR1 protein's minimal kinase activity in vitro suggests an improbable role as a tyrosine kinase in vivo. It serves as a receptor for WNT5A, activating NFkB signaling and potentially inhibiting WNT3A signaling. Notably, ROR1 plays a vital role in the inner ear, facilitating innervation of auditory hair cells by spiral ganglion neurons. ROR1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived ROR1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Background

ROR1 protein exhibits very low kinase activity in vitro, suggesting an unlikely role as a tyrosine kinase in vivo. It functions as a receptor for the ligand WNT5A, activating downstream NFkB signaling pathways and potentially inhibiting WNT3A-mediated signaling. Notably, in the inner ear, ROR1 is crucial for facilitating the innervation of auditory hair cells by spiral ganglion neurons.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

Q01973-1 (Q30-E403)

Gene ID
Molecular Construction
N-term
ROR1 (Q30-E403)
Accession # Q01973-1
6*His-Avi
C-term
Synonyms
Inactive tyrosine-protein kinase transmembrane receptor ROR1; Neurotrophictyrosine kinase, receptor-related 1; NTRKR1
AA Sequence

QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Molecular Weight

55-80 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ROR1 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P72410
Quantity:
MCE Japan Authorized Agent: