1. Recombinant Proteins
  2. Others
  3. RLN1/Relaxin-1 Protein, Human (HEK293, His)

The RLN1/Relaxin-1 protein is an important ovarian hormone that cooperates with estrogen to induce birth canal dilation. It plays a vital role in connective tissue remodeling during pregnancy, promoting pubic ligament growth and cervical ripening. RLN1/Relaxin-1 Protein, Human (HEK293, His) is the recombinant human-derived RLN1/Relaxin-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RLN1/Relaxin-1 protein is an important ovarian hormone that cooperates with estrogen to induce birth canal dilation. It plays a vital role in connective tissue remodeling during pregnancy, promoting pubic ligament growth and cervical ripening. RLN1/Relaxin-1 Protein, Human (HEK293, His) is the recombinant human-derived RLN1/Relaxin-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

RLN1, also known as Relaxin-1, is a vital ovarian hormone that collaborates with estrogen, particularly in numerous mammals, to induce the dilation of the birth canal. This hormone plays a crucial role in the remodeling of connective tissues during pregnancy, facilitating the growth of pubic ligaments and the ripening of the cervix. The functional form of RLN1 exists as a heterodimer, comprised of a B chain and an A chain, intricately linked by two disulfide bonds. Through its intricate molecular structure, RLN1 contributes significantly to the intricate processes associated with pregnancy, influencing the adaptive changes in the female reproductive system to support a successful birth.

Biological Activity

Measured by its ability to induce cAMP accumulation in THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 10.95 ng/mL, corresponding to a specific activity is 9.132×104 U/mg.

  • Measured by its ability to induce cAMP accumulation in THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 10.95 ng/mL, corresponding to a specific activity is 9.132×104 U/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P04808 (V23-C185)

Gene ID
Molecular Construction
N-term
RLN1 (V23-C185)
Accession # P04808
His
C-term
Synonyms
Prorelaxin H1; RLN1; RLXH1
AA Sequence

VAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFKKLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYC

Molecular Weight

Approximately 20 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RLN1/Relaxin-1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RLN1/Relaxin-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P77176
Quantity:
MCE Japan Authorized Agent: