RANTES/CCL5 Protein, Mouse

RANTES/CCL5 Protein, Mouse is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Mouse is a recombinant mouse CCL5(S24-S91) protein expressed by E. coli^[1].

CCL5, also known as RANTES (Regulation of Activation, Expression and Secretion by Normal T Cells), belongs to the CC subfamily of chemokines. The CCL5 gene is located in the q11.2-q12 region of human chromosome 17 and encodes CCL5 a protein with a molecular weight of 8 kDa. CCL5 can be expressed by T cells, monocytes, NK cells, epithelial cells, fibroblasts, and CCL5 can bind to receptors CCR1, CCR3, CCR4 and CCR5, with the highest affinity for CCR5^[1]. CCL5 binding to CCR5 leads to phosphorylation of phosphatidylinositol 3-kinase ( PI3K ), and the phosphorylated PI3K further acidifies protein kinase B on serine 473, and the Akt/PKB complex phosphorylates and inactivates the serine/threonine protein kinase GSK-3. In parallel, CCL5 binding to CCR5 induces Bcl2 protein expression, which promotes cell apoptosis. CCL5 can also act as a potential agonist for the G protein-coupled receptor GPR75, which, together with GPR75, may play a role in neuronal survival by activating downstream signaling pathways involving PI3, Akt, and MAP kinases, and in insulin secretion by pancreatic islet cells by activating GPR75^[2]. In addition to acting as a chemotactic agent, CCL5 is also a major HIV suppressor produced by CD⁸⁺ T cells. It is involved in inflammation maintenance, transplantation, antiviral immunity, tumor development, and many human diseases and disorders such as viral hepatitis or COVID-19^[3].

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T lymphocytes is in a concentration range of 1.0-10 ng/mL.

Mouse

E. coli

Tag Free

P30882 (S24-S91)

20304  [NCBI]

Full Length of Mature Protein

SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

Approximately 5-10 kDa, based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.22 μm concentrated solution in 30% Acetonitrile and 0.1% TFA.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. V Appay, et al. RANTES: a versatile and controversial chemokine. Trends Immunol. 2001 Feb;22(2):83-7.  [Content Brief]

  [2]. Zhen Zeng, et al. CCL5/CCR5 axis in human diseases and related treatments. Genes Dis. 2022 Jan;9(1):12-27.

  [3]. F Cocchi, et al. Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science. 1995 Dec 15;270(5243):1811-5.  [Content Brief]

  [4]. Sara González-Rodríguez, et al. Hyperalgesic and hypoalgesic mechanisms evoked by the acute administration of CCL5 in mice. Brain Behav Immun. 2017 May;62:151-161.  [Content Brief]