1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. PRKG1 Protein, Human (HEK293, His)

PRKG1 is a serine/threonine protein kinase that mediates the NO/c signaling pathway and phosphorylates various cellular proteins. It affects platelet activation, smooth muscle contraction, cardiac function, central nervous system processes, etc. PRKG1 Protein, Human (HEK293, His) is the recombinant human-derived PRKG1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRKG1 is a serine/threonine protein kinase that mediates the NO/c signaling pathway and phosphorylates various cellular proteins. It affects platelet activation, smooth muscle contraction, cardiac function, central nervous system processes, etc. PRKG1 Protein, Human (HEK293, His) is the recombinant human-derived PRKG1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

PRKG1, a serine/threonine protein kinase, serves as a key mediator in the nitric oxide (NO)/csignaling pathway. Activation by enables PRKG1 to phosphorylate serines and threonines on various cellular proteins, influencing multiple cellular processes. The protein targets of PRKG1 are diverse, impacting platelet activation and adhesion, smooth muscle contraction, cardiac function, gene expression, and feedback of the NO-signaling pathway. Within the central nervous system, PRKG1 plays roles in axon guidance, hippocampal and cerebellar learning, circadian rhythm, and nociception. Smooth muscle relaxation is achieved through the reduction of intracellular free calcium, desensitization of contractile proteins to calcium, and the modulation of platelet activation. PRKG1 regulates intracellular calcium levels through pathways such as phosphorylation of IRAG1, inhibition of IP3-induced Ca(2+) release, and phosphorylation of KCNMA1 (BKCa) channels. Additionally, PRKG1 influences gene expression in various tissues, impacting smooth muscle-specific contractile proteins and proteins in the NO/csignaling pathway. The activation of PRKG1 by NO signaling also plays a crucial role in inhibiting the Ras homolog gene family member A (RhoA), affecting processes like RHOA translocation, contraction, vesicle trafficking, and myosin light chain phosphorylation, ultimately leading to vasorelaxation. Furthermore, PRKG1 regulates the functions of vasodilator-stimulated phosphoprotein (VASP) in platelets and smooth muscle.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q13976-2 (G2-F686)

Gene ID
Molecular Construction
N-term
PRKG1 (G2-F686)
Accession # Q13976-2
6*His
C-term
Protein Length

Partial

Synonyms
cGMP-Dependent Protein Kinase 1; cGK 1; cGK1; cGMP-Dependent Protein Kinase I; cGKI; PRKG1; PRKG1B; PRKGR1A; PRKGR1B
AA Sequence

GTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF

Molecular Weight

Approximately 81.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 6% Sucrose, 4% Mannitol,0.05% Tween 80, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PRKG1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRKG1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71234
Quantity:
MCE Japan Authorized Agent: