1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. PPIE Protein, Human (His)

The PPIE protein is a key spliceosome component that complexly regulates pre-mRNA splicing through RNA binding and PPIase activity. It prefers single-stranded RNA with polyA and polyU stretches, indicating an affinity for the poly(A) region of the 3'-UTR. PPIE Protein, Human (His) is the recombinant human-derived PPIE protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PPIE protein is a key spliceosome component that complexly regulates pre-mRNA splicing through RNA binding and PPIase activity. It prefers single-stranded RNA with polyA and polyU stretches, indicating an affinity for the poly(A) region of the 3'-UTR. PPIE Protein, Human (His) is the recombinant human-derived PPIE protein, expressed by E. coli , with N-6*His labeled tag.

Background

PPIE protein plays a crucial role in pre-mRNA splicing as an integral component of the spliceosome. This multifunctional protein combines RNA-binding and peptidyl-prolyl cis-trans isomerase (PPIase) activities, contributing to the intricate process of splicing regulation. PPIE exhibits a preference for single-stranded RNA molecules with poly-A and poly-U stretches, suggesting its affinity for the poly(A)-region in the 3'-UTR of mRNA molecules. Beyond its role in RNA binding, PPIE catalyzes the cis-trans isomerization of proline imidic peptide bonds in proteins. Notably, it functions as an inhibitor of KMT2A activity, and this regulatory effect is contingent on its proline isomerase activity. The versatile functions of PPIE underscore its significance in coordinating various aspects of cellular processes, including RNA splicing and protein conformational changes.

Biological Activity

Measured by its ability to convert the 0.3mM substrate of Suc-AAPF-pNA, from Cis to Transformation. The specific activity is 4.156 nmol/min/μg.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9UNP9 (M1-V301)

Gene ID
Molecular Construction
N-term
6*His
PPIE (M1-V301)
Accession # Q9UNP9
C-term
Protein Length

Full Length

Synonyms
Peptidyl-Prolyl Cis-Trans Isomerase E; PPIase E; Cyclophilin E; Cyclophilin-33; Rotamase E; PPIE; CYP33
AA Sequence

MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV

Molecular Weight

Approximately 34.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PPIE Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PPIE Protein, Human (His)
Cat. No.:
HY-P71225
Quantity:
MCE Japan Authorized Agent: