1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Epithelial cell CD Proteins
  4. PD-L1 PD-L1
  5. PD-L1 Protein, Human (HEK293)

The PD-L1 protein critically regulates immune tolerance by acting as a ligand for PDCD1/PD-1, regulating T cell activation threshold, and limiting effector responses. It may act as a costimulatory molecule for IL10-producing T cell subsets. PD-L1 Protein, Human (HEK293) is the recombinant human-derived PD-L1 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PD-L1 protein critically regulates immune tolerance by acting as a ligand for PDCD1/PD-1, regulating T cell activation threshold, and limiting effector responses. It may act as a costimulatory molecule for IL10-producing T cell subsets. PD-L1 Protein, Human (HEK293) is the recombinant human-derived PD-L1 protein, expressed by HEK293 , with tag free.

Background

PD-L1 Protein assumes a critical role in both the induction and maintenance of immune tolerance to self, acting as a ligand for the inhibitory receptor PDCD1/PD-1 and thereby modulating the activation threshold of T-cells, ultimately limiting their effector response. Additionally, PD-L1 may function as a costimulatory molecule for T-cell subsets that predominantly produce interleukin-10 (IL10) through an as yet unidentified activating receptor. Beyond its role as an immune checkpoint, PD-L1 also acts as a transcription coactivator, translocating into the nucleus in response to hypoxia and interacting with phosphorylated STAT3 to promote the transcription of GSDMC, leading to pyroptosis. Exploited by tumors to attenuate anti-tumor immunity and escape immune system destruction, the PDCD1-mediated inhibitory pathway facilitated by PD-L1 interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function. Blocking the PDCD1-mediated pathway has shown promise in reversing exhausted T-cell phenotypes and normalizing anti-tumor responses, providing a rationale for cancer immunotherapy.

Biological Activity

1.Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is ≤0.2111 μg/ml in the presence of 10 μg/mL anti-CD3.
2.Measured by its binding ability in a functional ELISA. Immobilized Human PD-L1 at 1 μg/mL (100 μL/well) can bind Human PD-1. The ED50 for this effect is ≤0.8996 μg/mL.

  • Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL‑2 mouse cytotoxic T cells. The ED50 for this effect is 0.2191 μg/mL in the presence of 10μg/mL anti-CD3, corresponding to a specific activity is 4.56×103 units/mg.
Species

Human

Source

HEK293

Tag

Tag Free

Accession

Q9NZQ7-1/NP_054862.1 (F19-R238)

Gene ID
Molecular Construction
N-term
PD-L1 (F19-R238)
Accession # Q9NZQ7-1/NP_054862.1
C-term
Protein Length

Extracellular Domain

Synonyms
Programmed cell death 1 ligand 1; PD-L1; B7-H1; CD274; PDL1
AA Sequence

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Predicted Molecular Mass
25.19 kDa
Molecular Weight

Approximately 31-40 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
2. Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PD-L1 Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-L1 Protein, Human (HEK293)
Cat. No.:
HY-P73361
Quantity:
MCE Japan Authorized Agent: