1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Epithelial cell CD Proteins
  4. PD-L1 PD-L1
  5. PD-L1 Protein, Cynomolgus (HEK293, His)

CD274 molecule, also known as programmed death ligand 1 (PD-L1), binds to the checkpoint suppressor molecule PD-1 to inhibit TCR-mediated IL-2 production and T cell proliferation signaling. PD-L1 is involved in the PI3K/JAK/STAT signaling pathway to promote tumor occurrence. PD-L1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived PD-L1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD274 molecule, also known as programmed death ligand 1 (PD-L1), binds to the checkpoint suppressor molecule PD-1 to inhibit TCR-mediated IL-2 production and T cell proliferation signaling. PD-L1 is involved in the PI3K/JAK/STAT signaling pathway to promote tumor occurrence. PD-L1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived PD-L1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD274 molecule is also known as programmed death ligand 1 (PD-L1), and PD-L1 binds to the inhibitory checkpoint molecule PD-1 and interacts with phosphatase (SHP-1 or SHP-2) through the immune receptor tyrosinyl switch Motif (ITSM) to transmit inhibitory signals. The binding of PD-L1 to its receptor PD-1 on T cells transmits signals that inhibit TCR-mediated IL-2 production and T cell proliferation. By inhibiting ZAP70 phosphorylation and its association with CD3ζ. PD-1 signaling attenuates PKC-θ-activated ring phosphorylation (caused by TCR signaling), which is required for the activation of the transcription factors NF-κB and AP-1 and the production of IL-2. PD-L1 binding to PD-1 is also induced by the upregulation of the E3 ubiquitin ligase CPL-B. PD-L1 is involved in the PI3K/JAK/STAT signaling pathway to promote tumor occurrence[1][2][3][4].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus PD-L1 at 1 μg/mL (100 μL/well) can bind Biotinylated Cynomolgus PD-1 (HY-P70676). The ED50 for this effect is 0.121 μg/mL.

Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

G7PSE7 (F19-T239)

Gene ID
Molecular Construction
N-term
PD-L1 (F19-T239)
Accession # G7PSE7
6*His
C-term
Protein Length

Partial

Synonyms
B7-H; B7H1; B7-H1; PDCD1L1; CD274 molecule; CD274; PDCD1L1; PDCD1LG1; PDL1; PD-L1; PD-L1B7 homolog 1; PDL1PDCD1 ligand 1; programmed cell death 1 ligand 1; Programmed death ligand 1
AA Sequence

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEENHTAELVIPELPLALPPNERT

Molecular Weight

32-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

PD-L1 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-L1 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P70564
Quantity:
MCE Japan Authorized Agent: