OGT Protein, Human (His)

OGT Protein, Human (His) is the recombinant human-derived OGT protein, expressed by E. coli, with N-6*His & N-SUMO tag.

OGT is an enzyme that catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to serine or threonine residues in cytoplasmic and nuclear proteins, modifying them with a beta-linked N-acetylglucosamine (O-GlcNAc). It glycosylates a wide range of proteins, including histone H2B, AKT1, AMPK, ATG4B, CAPRIN1, EZH2, and others, regulating their cellular functions through crosstalk between glycosylation and phosphorylation or by affecting proteolytic processing. In muscle and adipocyte cells, OGT contributes to insulin resistance by glycosylating insulin signaling components and inhibiting AKT1 phosphorylation at 'Thr-308' (by similarity). Additionally, OGT regulates glycolysis by mediating the glycosylation of 6-phosphofructokinase PFKL, thereby inhibiting its activity. In chromatin structure, OGT plays a crucial role by mediating O-GlcNAcylation of histone H2B at 'Ser-112' and is recruited to CpG-rich transcription start sites of active genes via interaction with TET proteins (TET1, TET2, or TET3). The mitochondrial isoform (mOGT) exhibits cytotoxicity and induces apoptosis in various cell types, including the insulinoma cell line INS1.

Human

E. coli

N-6*His;N-SUMO

O15294-1 (M606-Q1022)

8473

Partial

MAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQ

Approximately 68 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.