1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. NPY Protein, Human (HEK293, His)

NPY protein is related to feeding behavior and GnRH secretion, and plays a crucial role in complex neural circuits that control appetite and energy balance. Its effects on GnRH secretion suggest a multifaceted role in the interplay between neural and endocrine pathways, particularly during reproduction. NPY Protein, Human (HEK293, His) is the recombinant human-derived NPY protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE NPY Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NPY protein is related to feeding behavior and GnRH secretion, and plays a crucial role in complex neural circuits that control appetite and energy balance. Its effects on GnRH secretion suggest a multifaceted role in the interplay between neural and endocrine pathways, particularly during reproduction. NPY Protein, Human (HEK293, His) is the recombinant human-derived NPY protein, expressed by HEK293 , with C-6*His labeled tag.

Background

NPY Protein is implicated in the regulation of feeding behavior and the secretion of gonadotrophin-releasing hormone (GnRH). Its involvement in the control of feeding suggests a key role in the complex neural circuits that modulate appetite and energy balance. Additionally, NPY's influence on GnRH secretion underscores its potential impact on reproductive processes, highlighting its multifaceted role in the intricate interplay between neural and endocrine pathways. Further research is essential to fully elucidate the molecular mechanisms through which NPY exerts its effects on feeding control and GnRH secretion, providing insights into its broader physiological functions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P01303 (Y29-W97)

Gene ID
Molecular Construction
N-term
NPY (Y29-W97)
Accession # P01303
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Pro-Neuropeptide Y; Neuropeptide Y; Neuropeptide Tyrosine; NPY; C-Flanking Peptide of NPY; CPON; NPY
AA Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW

Molecular Weight

Approximately 13.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NPY Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NPY Protein, Human (HEK293, His)
Cat. No.:
HY-P71063
Quantity:
MCE Japan Authorized Agent: