1. Recombinant Proteins
  2. Others
  3. NECAP2 Protein, Human (His)

NECAP2 protein plays a pivotal role in endocytosis, interacting with adapter protein complexes AP-1 and AP-2, specifically with AP1G1 and AP2A1. Additionally, it connects with GAE domain proteins GGA1, GGA2, and GGA3, participating in a network of interactions that orchestrate endocytic events. NECAP2 emerges as a key regulator in cellular processes associated with membrane trafficking and vesicular transport. NECAP2 Protein, Human (His) is the recombinant human-derived NECAP2 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NECAP2 protein plays a pivotal role in endocytosis, interacting with adapter protein complexes AP-1 and AP-2, specifically with AP1G1 and AP2A1. Additionally, it connects with GAE domain proteins GGA1, GGA2, and GGA3, participating in a network of interactions that orchestrate endocytic events. NECAP2 emerges as a key regulator in cellular processes associated with membrane trafficking and vesicular transport. NECAP2 Protein, Human (His) is the recombinant human-derived NECAP2 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Background

NECAP2 protein assumes a pivotal role in the intricate process of endocytosis, where it interfaces with crucial components of adapter protein complexes AP-1 and AP-2, specifically interacting with AP1G1 and AP2A1. Furthermore, NECAP2 establishes connections with the GAE domain proteins GGA1, GGA2, and GGA3, revealing its involvement in a network of molecular interactions that contribute to the orchestration of endocytic events. Through these associations, NECAP2 emerges as a key player in regulating cellular processes associated with membrane trafficking and vesicular transport.

Species

Human

Source

E. coli

Tag

N-6*His;C-6*His

Accession

Q9NVZ3 (M1-F263)

Gene ID
Molecular Construction
N-term
6*His
NECAP2 (M1-F263)
Accession # Q9NVZ3
6*His
C-term
Protein Length

Full Length

Synonyms
Adaptin ear-binding coat-associated protein 2; NECAP endocytosis associated protein 2; NECAP2
AA Sequence

MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF

Predicted Molecular Mass
31.5 kDa
Molecular Weight

Approximately 35 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NECAP2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NECAP2 Protein, Human (His)
Cat. No.:
HY-P70922
Quantity:
MCE Japan Authorized Agent: