1. Recombinant Proteins
  2. Others
  3. MOB4A/MOB1B Protein, Human (His)

In the Hippo signaling pathway, MOB4A/MOB1B is a key activator that controls organ size and suppresses tumors by regulating proliferation and promoting apoptosis. This pathway involves a kinase cascade in which STK3/MST2 and STK4/MST1 together with the regulatory protein SAV1 activate LATS1/2. MOB4A/MOB1B Protein, Human (His) is the recombinant human-derived MOB4A/MOB1B protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

In the Hippo signaling pathway, MOB4A/MOB1B is a key activator that controls organ size and suppresses tumors by regulating proliferation and promoting apoptosis. This pathway involves a kinase cascade in which STK3/MST2 and STK4/MST1 together with the regulatory protein SAV1 activate LATS1/2. MOB4A/MOB1B Protein, Human (His) is the recombinant human-derived MOB4A/MOB1B protein, expressed by E. coli , with N-6*His labeled tag.

Background

MOB4A, also known as MOB1B, functions as a crucial activator within the Hippo signaling pathway, playing a pivotal role in the control of organ size and tumor suppression by regulating proliferation and promoting apoptosis. The core of this pathway involves a kinase cascade, where STK3/MST2 and STK4/MST1, along with the regulatory protein SAV1, phosphorylate and activate LATS1/2. In conjunction with its regulatory partner MOB1B, LATS1/2 then phosphorylates and inactivates the YAP1 oncoprotein and WWTR1/TAZ. The phosphorylation of YAP1 by LATS1/2 prevents its translocation into the nucleus, thereby orchestrating the regulation of genes essential for cell proliferation, death, and migration. MOB4A/MOB1B also stimulates the kinase activity of STK38L and interacts with LATS1 and LATS2, contributing to the intricate regulatory network that governs the Hippo signaling pathway.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q7L9L4-1 (M1-R216)

Gene ID
Molecular Construction
N-term
6*His
MOB1B (M1-R216)
Accession # Q7L9L4-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
MOB kinase activator 1B; MOB4A; MOBKL1A; MOB1B
AA Sequence

MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR

Molecular Weight

Approximately 24 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MOB4A/MOB1B Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MOB4A/MOB1B Protein, Human (His)
Cat. No.:
HY-P77449
Quantity:
MCE Japan Authorized Agent: