1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MIP-1 beta/CCL4
  6. CCL4 Protein, Human

CCL4 Protein, Human is a small cytokine of the CC chemokine subfamily that binds to the CCR5 chemokine receptor on the cell surface, promotes leukocyte aggregation under various inflammatory conditions, and contributes to immune protection against human immunodeficiency virus type 1. CCL4 Protein, Human is a recombinant human CCL4 (A24-N92) expressed by E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE CCL4 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CCL4 Protein, Human is a small cytokine of the CC chemokine subfamily that binds to the CCR5 chemokine receptor on the cell surface, promotes leukocyte aggregation under various inflammatory conditions, and contributes to immune protection against human immunodeficiency virus type 1. CCL4 Protein, Human is a recombinant human CCL4 (A24-N92) expressed by E. coli[1].

Background

CCL4, also known as macrophage inflammatory protein (MIP-1β), belongs to the CC chemokine family and is a protein encoded in humans by the CCL4 gene, which belongs to the 17q11-q21 region of chromosome 17 and has a molecular weight of approximately 8-10 kDa. CCL4 can be produced by monocytes, B cells, T cells, NK cells, dendritic cells, neutrophils, fibroblasts, endothelial cells, and epithelial cells[1]. CCL4 acts as a chemokine that binds to the G protein-coupled receptors CCR5 and CCR8 and acts as a chemoattractant for natural killer cells, monocytes and various other immune cells at sites of inflammation or damaged tissues. In parallel, CCL4 can also act as a major HIV suppressor produced by CD8+ T cells, inducing dose-dependent inhibition of different strains of HIV-1, HIV-2 and monkey immunodeficiency virus (SIV). Among them, the N-terminal processed form CCL4 (3-69), produced by proteolytic cleavage of peripheral blood lymphocytes after secretion, retains the ability to induce down-regulation of chemokine receptor CCR5 surface expression and inhibit CCR5-mediated HIV-1 entry into T cells[2].

Biological Activity

1. The ED50 is <100 ng/mL as measured by CHO-K1/Gα15/hCCR5 cells (human Gα15 and human CCR5 stably expressed in CHO-K1 cells).
2. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 this effect is 2.785 ng/mL, corresponding to a specific activity is 3.59×105 U/mg.

  • Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 2.785 ng/mL, corresponding to a specific activity is 3.59×105 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P13236 (A24-N92)

Gene ID
Molecular Construction
N-term
CCL4 (A24-N92)
Accession # P13236
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuMIP-1β/CCL4; C-C motif chemokine 4; LAG-1; Macrophage inflammatory protein 1-beta; SCYA4
AA Sequence

APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN

Molecular Weight

7-17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCL4 Protein, Human
Cat. No.:
HY-P7257
Quantity:
MCE Japan Authorized Agent: