1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL12
  6. MCP-5/CCL12 Protein, Rat

The MCP-5/CCL12 protein belongs to the intercrine beta family and is essential for chemokines involved in intercellular communication and immune responses. In this family, MCP-5/CCL12 may play a role in regulating inflammatory processes and cellular interactions. MCP-5/CCL12 Protein, Rat is the recombinant rat-derived MCP-5/CCL12 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MCP-5/CCL12 protein belongs to the intercrine beta family and is essential for chemokines involved in intercellular communication and immune responses. In this family, MCP-5/CCL12 may play a role in regulating inflammatory processes and cellular interactions. MCP-5/CCL12 Protein, Rat is the recombinant rat-derived MCP-5/CCL12 protein, expressed by E. coli , with tag free.

Background

MCP-5/CCL12 protein is a member of the intercrine beta (chemokine CC) family, categorizing it within a group of chemokines known for their role in intercellular communication and immune responses. As part of the intercrine beta family, MCP-5/CCL12 is likely involved in the modulation of inflammatory processes and cellular interactions. Further investigation is essential to unravel the specific functions and implications of MCP-5/CCL12 within the broader context of the chemokine CC family, shedding light on its significance in mediating immune responses and contributing to the intricate network of intercellular signaling.

Biological Activity

Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/mL.

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

Q9QZU1 (G14-A81)

Gene ID

/

Molecular Construction
N-term
CCL12 (G14-A81)
Accession # Q9QZU1
C-term
Synonyms
C-C motif chemokine; CCL12
AA Sequence

GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA

Molecular Weight

Approximately 7.9 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MCP-5/CCL12 Protein, Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MCP-5/CCL12 Protein, Rat
Cat. No.:
HY-P71903
Quantity:
MCE Japan Authorized Agent: