1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL13
  6. MCP-4/CCL13 Protein, Human

MCP-4/CCL13 Protein, Human is a CC family chemokine with chemotactic effects on basophils, monocytes, macrophages, immature dendritic cells and T cells. CCL13 binds to CCR1, CCR2, CCR3, CCR5, and CCR11 chemokine receptors and is able to induce key immunomodulatory responses through its effects on regulatory muscle, epithelial, and endothelial cells. MCP-4/CCL13 Protein, Human is a recombinant human MCP-4/CCL13 (Q24-T98) protein expressed by E.coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE MCP-4/CCL13 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MCP-4/CCL13 Protein, Human is a CC family chemokine with chemotactic effects on basophils, monocytes, macrophages, immature dendritic cells and T cells. CCL13 binds to CCR1, CCR2, CCR3, CCR5, and CCR11 chemokine receptors and is able to induce key immunomodulatory responses through its effects on regulatory muscle, epithelial, and endothelial cells. MCP-4/CCL13 Protein, Human is a recombinant human MCP-4/CCL13 (Q24-T98) protein expressed by E.coli[1][2].

Background

CCL13, also known as monocyte chemotactic protein MCP-4, is a small cell factor belonging to the CC chemokine family and is located on human chromosome 17. At the amino acid level, human CCL13 shares 65% identity with human CCL2. CCL13 can act as a chemoattractant for monocytes, macrophages, T lymphocytes, immature DCs, eosinophils, and basophils by binding to cell surface G protein-linked chemokine receptors such as CCR1, CCR2, CCR3, CCR5, and CCR11. CCL13 also induces histamine release from basophils and eosinophil degranulation, and causes expression of adhesion molecules and production of pro-inflammatory cytokines in endothelial cells, epithelial cells and muscle cells[1]. CCL13 plays a role in leukocyte accumulation on both sides of allergic and non-allergic inflammation. Studies have shown that CCL13 is upregulated in asthma and allergic rhinitis and is associated with the number of monocytes/macrophages and eosinophils recruited in the airways of patients. It may be involved in the recruitment of monocytes to the arterial wall during atherosclerotic disease and plays a role in the attraction of monocytes in tissues chronically exposed to exogenous pathogens. ccl13 may also contribute to the development of drug resistance in tumor cells by promoting apoptosis and drug resistance[2].

Biological Activity

1. Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration range of 10-100 ng/mL.
2. Measured by its ability to chemoattract THP-1 cells. The ED50 this effect is 18.2 ng/mL, corresponding to a specific activity is 5.49×104 units/mg.

  • Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 18.2 ng/mL, corresponding to a specific activity is 5.49×104 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q99616 (Q24-T98)

Gene ID
Molecular Construction
N-term
CCL13 (Q24-T98)
Accession # Q99616
C-term
Protein Length

Partial

Synonyms
rHuMCP-4/CCL13; C-C motif chemokine 13; MCP4; SCYA13
AA Sequence

QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT

Predicted Molecular Mass
8.6 kDa
Molecular Weight

Approximately 12.6 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MCP-4/CCL13 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MCP-4/CCL13 Protein, Human
Cat. No.:
HY-P7245
Quantity:
MCE Japan Authorized Agent: