1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. C Chemokines
  5. XCL1
  6. Lymphotactin/XCL1 Protein, Human

XCL1, a C class chemokine also known as Lymphotactin, is mainly produced by activated CD8+ T cells and natural killer cells. XCL1 signals by binding to the XCR1 receptor. XCL1 is involved in infectious, inflammatory and immunological diseases. Lymphotactin/XCL1 Protein, Human (HEK293, Fc-His) is produced in E. coli, and consists of 92 amino acids (G23-G114).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

XCL1, a C class chemokine also known as Lymphotactin, is mainly produced by activated CD8+ T cells and natural killer cells. XCL1 signals by binding to the XCR1 receptor. XCL1 is involved in infectious, inflammatory and immunological diseases[1]. Lymphotactin/XCL1 Protein, Human (HEK293, Fc-His) is produced in E. coli, and consists of 92 amino acids (G23-G114).

Background

XCL1, also known as lymphotactin, single C motif-1 (SCM-1), and activation-induced T-cell-derived and chemokine-related molecule (ATAC). XCL1 is expressed by various immune cells, including activated CD8+ T cells, CD4+ T cells, NK cells, NKT cells, γδ T cells, and thymic medullary epithelial cells. XCL1 elicits its chemotactic function by binding to the receptor called XCR1. XCR1 is expressed by a dendritic cell (DC) subpopulation[1].
  There are two highly homologous C class chemokine genes in human, XCL1 and XCL2 (also known as SCYC1 and SCYC2, respectively). The XCL1 and XCL2 genes in human are localized closely on chromosome 1 and encode highly homologous proteins (also known as SCM-1K and SCM-1L, respectively) with only two amino acid differences from each other. Unlike CXC, CC, and CX3C class chemokines that carry two disulfide bonds with four cysteine residues at the amino termini, XCL1 has only one disulfide bond with two cysteine residues at the amino terminus. Human and mouse XCL1s share 60% amino acid identity. XCL1 transcripts are detected in spleen, thymus, intestine, and peripheral blood leukocytes. XCL1 expression is also detectable in lung, colon, prostate gland, testis, and ovary. In leukocytes, XCL1 is highly expressed in CD8+ and CD4-CD8- TCRαβ+ T cells in blood and thymus, particularly when the cells are activated. TCRαβ+ T cells in epidermis and intestinal epithelium also express XCL1[1].
XCL1 exerts chemotactic and immunomodulatory activity on T cells, natural killer (NK) cells, and macrophages. The interaction between XCL1 and XCR1 plays an important role in DC-mediated immune response and thymic development of regulatory T cells. It has been also shown that XCL1 and XCR1 are constitutively expressed in the thymus and regulate the thymic establishment of self-tolerance and the generation of regulatory T cells. The elevated expression of XCL1 in various infectious and autoimmune diseases suggests the role of the XCL1-XCR1 axis in protective and pathological immune responses. In addition, XCL1 plays a role in the development of arthritis and progressive bone degradation in rheumatoid arthritis[1][2].

In Vitro

Recombinant human XCL1 (10, 50, or 100 ng/mL; 48 hours) promotes osteoclastogenesis and the osteoclast-bone resorbing activity in human monocytes. Moreover, recombinant XCL1 promotes the expression of inflammatory and osteoclastogenic factors, including IL-6, IL-8, and RANKL in human differentiated osteoblasts[2].

In Vivo

Lei Y, et al. XCL1 and XCR1 in the immune system. Microbes Infect. 2012 Mar;14(3):262-7.

Biological Activity


1.Full biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 10-100 ng/ml.
2.Measured by its ability to chemoattract NK92 cells. The ED50 for this effect is 0.0734 μg/mL, corresponding to a specific activity is 1.362×104 U/mg.

  • Measured by its ability to chemoattract NK92 cells. The ED50 for this effect is 0.0734 μg/mL, corresponding to a specific activity is 1.362×104 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P47992 (G23-G114)

Gene ID
Molecular Construction
N-term
XCL1 (G23-G114)
Accession # P47992
C-term
Protein Length

Partial

Synonyms
rHuLymphotactin/XCL1; ATAC; SCYC1
AA Sequence

GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Predicted Molecular Mass
10.2 kDa
Molecular Weight

Approximately 10.2-15 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 150 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Lymphotactin/XCL1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lymphotactin/XCL1 Protein, Human
Cat. No.:
HY-P7234
Quantity:
MCE Japan Authorized Agent: