1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Livin/BIRC7 Protein, Human (His)

Livin/BIRC7 is an apoptosis regulator that coordinates pro- and anti-apoptotic activities and is critical for apoptosis, cell proliferation, and cell cycle control. Its anti-apoptotic functions include inhibition of CASP3, CASP7 and CASP9, as well as E3 ubiquitin protein ligase activity. Livin/BIRC7 Protein, Human (His) is the recombinant human-derived Livin/BIRC7 protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Livin/BIRC7 is an apoptosis regulator that coordinates pro- and anti-apoptotic activities and is critical for apoptosis, cell proliferation, and cell cycle control. Its anti-apoptotic functions include inhibition of CASP3, CASP7 and CASP9, as well as E3 ubiquitin protein ligase activity. Livin/BIRC7 Protein, Human (His) is the recombinant human-derived Livin/BIRC7 protein, expressed by E. coli , with C-His labeled tag.

Background

Livin/BIRC7, an apoptotic regulator, intricately modulates both proapoptotic and anti-apoptotic activities, holding pivotal roles in apoptosis, cell proliferation, and cell cycle control. Its anti-apoptotic prowess stems from the inhibition of CASP3, CASP7, and CASP9, coupled with its E3 ubiquitin-protein ligase activity. Despite its classification as a weak caspase inhibitor, Livin's anti-apoptotic function is attributed to its capability to ubiquitinate DIABLO/SMAC, directing it for degradation and thereby fostering cell survival. Furthermore, Livin may hinder DIABLO/SMAC from disrupting XIAP/BIRC4-caspase interactions, potentially contributing to caspase inhibition. Notably, Livin safeguards against apoptosis induced by TNF or chemical agents like adriamycin, etoposide, or staurosporine. This protective effect is facilitated through the activation of MAPK8/JNK1 and possibly MAPK9/JNK2, contingent upon TAB1 and MAP3K7/TAK1. Livin's multifaceted functions also extend to inhibiting CASP3 and impeding the proteolytic activation of pro-CASP9 in vitro, as well as blocking staurosporine-induced apoptosis. Moreover, Livin promotes natural killer (NK) cell-mediated killing, underscoring its diverse regulatory roles in cellular processes.

Biological Activity

Measured by its ability to inhibit DEVD-AFC cleavage activity in cell extracts activated by addition of cytochrome c and dATP. The IC50 value is 1.223 nM, as measured under the described conditions.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q96CA5-1 (M1-S298)

Gene ID
Molecular Construction
N-term
Livin (M1-S298)
Accession # Q96CA5-1
His
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Baculoviral IAP repeat-containing protein 7; KIAP; MLIAP; RNF50
AA Sequence

MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS

Molecular Weight

Approximately 35 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 200 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Livin/BIRC7 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Livin/BIRC7 Protein, Human (His)
Cat. No.:
HY-P77065
Quantity:
MCE Japan Authorized Agent: