1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins
  4. TNF Superfamily Ligands
  5. LIGHT/CD258
  6. LIGHT/TNFSF14 Protein, Human (HEK293, Fc)

LIGHT/TNFSF14 protein (CD258; TNFRSF14) is a type II transmembrane protein produced by activated T cells. It is a TNFRSF14/HVEM ligand and belongs to the tumor necrosis factor (TNF) family. LIGHT/TNFSF14 is mainly expressed in spleen, with two subtypes: membrane-bound type and soluble type . LIGHT/TNFSF14 protein can be used as immune checkpoint molecule of tumor, and stimulate natural killer cells to produce interferon TFNγ, triggering tumor apoptosis signal . LIGHT/TNFSF14 is also involved in the dominant LTβR-NIK-p52 NF-κB pathway promoting the expression of inflammatory gene. In addition, LIGHT/TNFSF14 protein is a co-stimulatory factor that activates lymphoid cells and has an inhibitory effect on herpes virus infection. Human LIGHT/TNFSF14 Protein has 240 amino acids and a transmembrane domain (38-58 a.a.). LIGHT/TNFSF14 Protein, Human (HEK293, Fc) is the extracellular part (D74-V240) of human LIGHT/TNFSF14 Protein, produced by HEK293 cells, with a N-terminal hFc-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

LIGHT/TNFSF14 protein (CD258; TNFRSF14) is a type II transmembrane protein produced by activated T cells. It is a TNFRSF14/HVEM ligand and belongs to the tumor necrosis factor (TNF) family. LIGHT/TNFSF14 is mainly expressed in spleen, with two subtypes: membrane-bound type and soluble type [1]. LIGHT/TNFSF14 protein can be used as immune checkpoint molecule of tumor, and stimulate natural killer cells to produce interferon TFNγ, triggering tumor apoptosis signal [2]. LIGHT/TNFSF14 is also involved in the dominant LTβR-NIK-p52 NF-κB pathway promoting the expression of inflammatory gene[3]. In addition, LIGHT/TNFSF14 protein is a co-stimulatory factor that activates lymphoid cells and has an inhibitory effect on herpes virus infection[4]. Human LIGHT/TNFSF14 Protein has 240 amino acids and a transmembrane domain (38-58 a.a.). LIGHT/TNFSF14 Protein, Human (HEK293, Fc) is the extracellular part (D74-V240) of human LIGHT/TNFSF14 Protein, produced by HEK293 cells, with a N-terminal hFc-tag.

Background

LIGHT/TNFSF14 is a type II transmembrane protein produced by activated T cells, belongs to tumor necrosis factor (TNF) family. LIGHT/TNFSF14 is a TNFRSF14/HVEM (herpesvirus entry mediator) ligand, engages the receptor for the LTalphabeta heterotrimer but does not form complexes with either secreted lymphotoxin alpha (LTalpha) or LTbeta[1].
LIGHT/TNFSF14 is predominantly expressed in the spleen but also found in the brain. It is weakly expressed in peripheral lymphoid tissues and in heart, placenta, liver, lung, appendix, and kidney, and no expression seen in fetal tissues, endocrine glands, or nonhematopoietic tumor lines[1].
LIGHT/TNFSF14 has a transmemberane, thus it can be leaved into 2 chains: membrane form and soluble form. The soluble form of isoform 1 derives from the membrane form by proteolytic processing.
In tumor immunology, TNFSF14/LIGHT also serves as a novel immune checkpoint molecule for glioblastoma multiforme (GBM), as well as lung carcinoma, breast carcinoma, cervical cancer, and prostate cancer. TNFSF14/LIGHT can stimulate NK cells to produce IFNγ via nuclear factor-κB (NFκB) RelA/p50 signaling. TNFSF14/LIGHT sustains the function of CD8+ effector T cells, trigger apoptosis of various tumor cells[2].
In cell signaling, TNFSF14/LIGHT binds to lymphotoxin-β receptor (LTβR) and HVEM for activating both of them, and disrupts the HVEM-BTLA complex in surface-bound form, and facilitates HVEM-BTLA complex formation in the soluble form[2].
TNFSF14/LIGHT promotes an inflammatory esophageal fibroblast in vitro via a LTβR-NIK-p52 NF-κB dominant pathway with promoting inflammatory gene expression and down-regulating homeostatic factors including WNTs, BMPs and type 3 semaphorins[3].
Beside that, TNFSF14/LIGHT protein is a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. TNFSF14/LIGHT also prevents tumor necrosis factor alpha mediated apoptosis in primary hepatocyte[4][5].

In Vivo

Exogenous LIGHT/TNFSF14 (human; 1 ng/mL; 24 h, 48 h, and 96 h) effectively reverses the inhibitory effects of miR-326 overexpression on the expression levels of collagen I and fibronectin, and promotes cell proliferation of TGF-β1-treated airway smooth muscle cells (ASMCs)[6].
LIGHT/TNFSF14 (human; 1 ng/mL; 24 h) induces increased expression of CD4, CD86, and HLA-DR in stimulation of iDCs (generated in vitro from CD14+ monocytes)[7].

Biological Activity

Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 this effect is 2.816 ng/ml, corresponding to a specific activity is 3.55×105 units/mg.

  • Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 this effect is 2.816 ng/mL, corresponding to a specific activity is 3.55×105 units/mg.
Species

Human

Source

HEK293

Tag

N-hFc

Accession

O43557 (D74-V240)

Gene ID
Molecular Construction
N-term
hFc
LIGHT (D74-V240)
Accession # O43557
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor ligand superfamily member 14; TNFSF14; HVEM-L; LIGHT  
AA Sequence

DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Predicted Molecular Mass
44.2 kDa
Molecular Weight

Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LIGHT/TNFSF14 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P73281
Quantity:
MCE Japan Authorized Agent: