1. Recombinant Proteins
  2. Others
  3. JTB Protein, Human (HEK293, Fc)

JTB proteins are critical for normal cytokinesis progression, regulate cell proliferation, and may serve as components of the chromosomal passenger complex (CPC) during mitosis. It interacts with key CPC components, affects AURKB activity, and exhibits anti-apoptotic properties, inhibiting TGFB1-induced apoptosis. JTB Protein, Human (HEK293, Fc) is the recombinant human-derived JTB protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

JTB proteins are critical for normal cytokinesis progression, regulate cell proliferation, and may serve as components of the chromosomal passenger complex (CPC) during mitosis. It interacts with key CPC components, affects AURKB activity, and exhibits anti-apoptotic properties, inhibiting TGFB1-induced apoptosis. JTB Protein, Human (HEK293, Fc) is the recombinant human-derived JTB protein, expressed by HEK293 , with C-mFc labeled tag.

Background

JTB protein is indispensable for the normal progression of cytokinesis during mitosis and plays a crucial role in regulating cell proliferation. It is implicated as a potential component of the chromosomal passenger complex (CPC), a pivotal regulator of mitosis with essential functions at the centromere. The CPC complex is instrumental in ensuring accurate chromosome alignment and segregation, as well as participating in chromatin-induced microtubule stabilization and spindle assembly. JTB interacts with key components of the CPC, including AURKA, AURKB, BIRC5, and INCENP, potentially influencing AURKB activity. Moreover, JTB exhibits anti-apoptotic properties, inhibiting apoptosis induced by TGFB1, and its overexpression is associated with mitochondrial changes, leading to mitochondrial swelling and reduced membrane potential. These multifaceted roles highlight JTB's involvement in intricate cellular processes crucial for mitotic fidelity and cell survival.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

O76095-1 (E31-L105)

Gene ID
Molecular Construction
N-term
JTB (E31-L105)
Accession # O76095
mFc
C-term
Synonyms
Jumping translocation breakpoint protein; Prostate androgen-regulated protein; JTB; HSPC222
AA Sequence

EAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL

Molecular Weight

Approximately 39 kDa due to the glycosylation

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

JTB Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
JTB Protein, Human (HEK293, Fc)
Cat. No.:
HY-P75896
Quantity:
MCE Japan Authorized Agent: