1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. IGF family Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. IGF-I R/CD221 IGF-I R/CD221
  5. IGF-I R Protein, Human (His)

IGF-I receptor (IGF1R) mediates insulin-like growth factor effects, binding strongly to IGF1. Activation triggers PI3K-AKT/PKB and Ras-MAPK pathways, influencing cell survival, protein synthesis, and proliferation. IGF1R also signals through JAK/STAT, inhibiting JNK activation. Hybrid receptors show variable binding to IGF1 and insulin. IGF-I R Protein, Human (His) is the recombinant human-derived IGF-I R protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IGF-I receptor (IGF1R) mediates insulin-like growth factor effects, binding strongly to IGF1. Activation triggers PI3K-AKT/PKB and Ras-MAPK pathways, influencing cell survival, protein synthesis, and proliferation. IGF1R also signals through JAK/STAT, inhibiting JNK activation. Hybrid receptors show variable binding to IGF1 and insulin. IGF-I R Protein, Human (His) is the recombinant human-derived IGF-I R protein, expressed by E. coli , with N-6*His labeled tag.

Background

The IGF-I receptor (IGF1R) is a receptor tyrosine kinase that plays a pivotal role in mediating the actions of insulin-like growth factor 1 (IGF1). It exhibits high affinity for IGF1 and lower affinity for IGF2 and insulin (INS). Upon ligand binding, IGF1R activates its kinase, leading to receptor autophosphorylation and tyrosine phosphorylation of various substrates, including insulin-receptor substrates (IRS1/2), Shc, and 14-3-3 proteins. This initiates two main signaling pathways: the PI3K-AKT/PKB pathway, which inhibits apoptosis and stimulates protein synthesis, and the Ras-MAPK pathway, promoting increased cellular proliferation. Phosphorylated IRS1 can activate the PI3K pathway, leading to downstream activation of AKT/PKB and subsequent enhancement of protein synthesis and antiapoptotic effects. Simultaneously, recruitment of Grb2/SOS by phosphorylated IRS1 or Shc activates the Ras-MAPK pathway. Additionally, IGF1R signals through the JAK/STAT pathway, potentially contributing to its transforming activity. The JNK kinases can also be activated by IGF1R, and IGF1 inhibits JNK activation by phosphorylating and inhibiting MAP3K5/ASK1. Hybrid receptors composed of IGF1R and INSR isoforms exhibit varying binding characteristics, indicating high affinity for IGF1 and low affinity for insulin.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P08069 (Y763-E931)

Gene ID
Molecular Construction
N-term
6*His
IGF-I R (Y763-E931)
Accession # P08069
C-term
Protein Length

Partial

Synonyms
CD221; CD221 antigen ; IGF 1 receptor; IGF 1R; IGF I receptor; IGF-I receptor; Igf1r; IGF1R_HUMAN; IGFIR; IGFIRC; IGFR; Insulin like growth factor 1 receptor; Insulin like growth factor 1 receptor precursor; Insulin-like growth factor 1 receptor beta chain; Insulin-like growth factor I receptor; JTK13; MGC142170; MGC142172; MGC18216; Soluble IGF1R variant 1; Soluble IGF1R variant 2
AA Sequence

YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE

Molecular Weight

Approximately 27 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IGF-I R Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGF-I R Protein, Human (His)
Cat. No.:
HY-P72256
Quantity:
MCE Japan Authorized Agent: