1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. HPSE Protein, Rat (His-Myc)

HPSE proteins cleave HSPG into heparan sulfate side chains and decorin, involved in ECM degradation and remodeling. HPSE promotes cell migration associated with metastasis, wound healing, and inflammation and acts as a procoagulant. HPSE also induces AKT1/PKB phosphorylation, enhancing angiogenesis, hair follicle differentiation and homeostasis. HPSE Protein, Rat (His-Myc) is the recombinant rat-derived HPSE protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HPSE proteins cleave HSPG into heparan sulfate side chains and decorin, involved in ECM degradation and remodeling. HPSE promotes cell migration associated with metastasis, wound healing, and inflammation and acts as a procoagulant. HPSE also induces AKT1/PKB phosphorylation, enhancing angiogenesis, hair follicle differentiation and homeostasis. HPSE Protein, Rat (His-Myc) is the recombinant rat-derived HPSE protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Background

HPSE Protein functions as an endoglycosidase, playing a crucial role in the cleavage of heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. This enzymatic activity contributes to extracellular matrix (ECM) degradation and remodeling, selectively cleaving linkages within glucuronic acid units and N-sulfo glucosamine units carrying specific sulfation patterns. While predominantly inactive at neutral pH, HPSE becomes active under acidic conditions, such as during tumor invasion and inflammatory processes. This protein is implicated in various cellular processes, including facilitating cell migration associated with metastasis, wound healing, and inflammation. It enhances shedding of syndecans, promotes endothelial invasion and angiogenesis in myelomas, and acts as a procoagulant by increasing the generation of activation factor X in the presence of tissue factor and activation factor VII. Notably, HPSE also plays a role in cell adhesion to the ECM, independent of its enzymatic activity, and induces AKT1/PKB phosphorylation, thereby increasing cell mobility and invasion. Additionally, HPSE is involved in the regulation of osteogenesis, promotes angiogenesis through up-regulation of SRC-mediated activation of VEGF, and is implicated in hair follicle inner root sheath differentiation and hair homeostasis.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Rat

Source

E. coli

Tag

N-10*His;C-Myc

Accession

Q71RP1 (K29-E102)

Gene ID
Molecular Construction
N-term
10*His
HPSE (K29-E102)
Accession # Q71RP1
C-term
Protein Length

Full Length of Hpse 8 kDa subunit

Synonyms
Hpse; HepHeparanase; EC 3.2.1.166; Endo-glucoronidase; Heparanase 8 kDa subunit; Heparanase 50 kDa subunit
AA Sequence

KDVVDLEFYTKRLFQSVSPSFLSITIDASLATDPRFLTFLGSPRLRALARGLSPAYLRFGGTKTDFLIFDPNKE

Molecular Weight

Approximately 15.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HPSE Protein, Rat (His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HPSE Protein, Rat (His-Myc)
Cat. No.:
HY-P72235
Quantity:
MCE Japan Authorized Agent: