1. Recombinant Proteins
  2. Others
  3. HLA-G Protein, Human (His-SUMO)

HLA-G is a nonclassical major histocompatibility class Ib molecule that is critical for immune regulation at the maternal-fetal interface. It cooperates with B2M to form a complex that selectively binds self-peptides to promote maternal-fetal tolerance by interacting with KIR2DL4, LILRB1, and LILRB2 receptors. HLA-G Protein, Human (His-SUMO) is the recombinant human-derived HLA-G protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HLA-G is a nonclassical major histocompatibility class Ib molecule that is critical for immune regulation at the maternal-fetal interface. It cooperates with B2M to form a complex that selectively binds self-peptides to promote maternal-fetal tolerance by interacting with KIR2DL4, LILRB1, and LILRB2 receptors. HLA-G Protein, Human (His-SUMO) is the recombinant human-derived HLA-G protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

HLA-G, a non-classical major histocompatibility class Ib molecule, plays a crucial role in immune regulation at the maternal-fetal interface. In association with B2M/beta-2 microglobulin, it forms a complex that selectively binds a limited repertoire of nonamer self-peptides derived from intracellular proteins, including histones and ribosomal proteins. This peptide-bound HLA-G-B2M complex acts as a ligand for inhibitory/activating KIR2DL4, LILRB1, and LILRB2 receptors on uterine immune cells, fostering fetal development while maintaining maternal-fetal tolerance. Interactions with KIR2DL4 and LILRB1 receptors trigger NK cell senescence-associated secretory phenotype, promoting vascular remodeling and fetal growth during early pregnancy. Moreover, HLA-G's engagement with LILRB2 induces the differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, actively contributing to the maintenance of maternal-fetal tolerance. Additionally, HLA-G may play a role in balancing tolerance and antiviral immunity by modulating the effector functions of NK cells, CD8+ T cells, and B cells. Furthermore, it negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity, highlighting its multifaceted role in immune regulation at the maternal-fetal interface.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P17693-1 (G25-D338)

Gene ID
Molecular Construction
N-term
6*His-SUMO
HLA-G (G25-D338)
Accession # P17693-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
B2 microglobulin; DADB-15K14.8; HLA 6.0; HLA class I histocompatibility antigen alpha chain G; HLA class I histocompatibility antigen; alpha chain G; HLA class I molecule; HLA G; HLA G antigen; HLA G histocompatibility antigen class I G; HLA G3; HLA-G; HLA-G histocompatibility antigen; class I; HLA60; HLAG; HLAG_HUMAN; Major histocompatibility complex class I G; MHC class I antigen; MHC class I antigen G; MHC G; T-cell A locus; TCA
AA Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Predicted Molecular Mass
51.6 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HLA-G Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HLA-G Protein, Human (His-SUMO)
Cat. No.:
HY-P72227
Quantity:
MCE Japan Authorized Agent: